BLASTX nr result
ID: Zanthoxylum22_contig00031733
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00031733 (423 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006476551.1| PREDICTED: uncharacterized protein LOC102629... 89 2e-15 gb|KDO76237.1| hypothetical protein CISIN_1g036351mg [Citrus sin... 85 2e-14 ref|XP_006439533.1| hypothetical protein CICLE_v10019505mg [Citr... 85 2e-14 ref|XP_010660598.1| PREDICTED: uncharacterized protein LOC104881... 63 8e-08 ref|XP_007040263.1| Uncharacterized protein TCM_016269 [Theobrom... 61 3e-07 ref|XP_012086885.1| PREDICTED: uncharacterized protein LOC105645... 57 7e-06 ref|XP_002509813.1| hypothetical protein RCOM_1687010 [Ricinus c... 57 7e-06 >ref|XP_006476551.1| PREDICTED: uncharacterized protein LOC102629382 isoform X1 [Citrus sinensis] gi|568845382|ref|XP_006476552.1| PREDICTED: uncharacterized protein LOC102629382 isoform X2 [Citrus sinensis] gi|568845384|ref|XP_006476553.1| PREDICTED: uncharacterized protein LOC102629382 isoform X3 [Citrus sinensis] Length = 567 Score = 88.6 bits (218), Expect = 2e-15 Identities = 41/58 (70%), Positives = 47/58 (81%) Frame = -3 Query: 421 NTLDLRMNGGAITFSGGSYALSENFATYNLIGHSNHRADGRLMPCQIPSVADDYLFPK 248 NTL ++MNGGAITF GGSYA SENF T NL+ S++RADGRL CQIPS+ D YLFPK Sbjct: 510 NTLGIQMNGGAITFPGGSYASSENFVTNNLLSQSDYRADGRLRHCQIPSITDAYLFPK 567 >gb|KDO76237.1| hypothetical protein CISIN_1g036351mg [Citrus sinensis] Length = 531 Score = 84.7 bits (208), Expect = 2e-14 Identities = 39/58 (67%), Positives = 46/58 (79%) Frame = -3 Query: 421 NTLDLRMNGGAITFSGGSYALSENFATYNLIGHSNHRADGRLMPCQIPSVADDYLFPK 248 NTL ++MNGGAITF GGSYA SENF T NL+ +++RADGRL CQIPS+ D Y FPK Sbjct: 474 NTLGMQMNGGAITFPGGSYASSENFVTNNLLSQTDYRADGRLRHCQIPSITDAYPFPK 531 >ref|XP_006439533.1| hypothetical protein CICLE_v10019505mg [Citrus clementina] gi|557541795|gb|ESR52773.1| hypothetical protein CICLE_v10019505mg [Citrus clementina] Length = 567 Score = 84.7 bits (208), Expect = 2e-14 Identities = 39/58 (67%), Positives = 46/58 (79%) Frame = -3 Query: 421 NTLDLRMNGGAITFSGGSYALSENFATYNLIGHSNHRADGRLMPCQIPSVADDYLFPK 248 NTL ++MNGGAITF GGSYA SENF T NL+ +++RADGRL CQIPS+ D Y FPK Sbjct: 510 NTLGMQMNGGAITFPGGSYASSENFVTNNLLSQTDYRADGRLRHCQIPSITDAYPFPK 567 >ref|XP_010660598.1| PREDICTED: uncharacterized protein LOC104881633 [Vitis vinifera] Length = 530 Score = 63.2 bits (152), Expect = 8e-08 Identities = 31/56 (55%), Positives = 36/56 (64%) Frame = -3 Query: 421 NTLDLRMNGGAITFSGGSYALSENFATYNLIGHSNHRADGRLMPCQIPSVADDYLF 254 N L LRMNGGAI FS GS A E+F NL H N++ADG LM Q P + D +LF Sbjct: 473 NILGLRMNGGAIRFSAGSNAFPEHFVANNLRSHLNYKADGGLMAFQTPDIKDSHLF 528 >ref|XP_007040263.1| Uncharacterized protein TCM_016269 [Theobroma cacao] gi|508777508|gb|EOY24764.1| Uncharacterized protein TCM_016269 [Theobroma cacao] Length = 564 Score = 61.2 bits (147), Expect = 3e-07 Identities = 30/57 (52%), Positives = 39/57 (68%) Frame = -3 Query: 418 TLDLRMNGGAITFSGGSYALSENFATYNLIGHSNHRADGRLMPCQIPSVADDYLFPK 248 TL LRMNGGAI F GG+Y LSE+ A N HS +++D L CQ+ ++ D +LFPK Sbjct: 508 TLALRMNGGAIRFPGGTYNLSEHPAANNCHFHSTYQSDSGLTLCQLQNIKDGHLFPK 564 >ref|XP_012086885.1| PREDICTED: uncharacterized protein LOC105645797 [Jatropha curcas] gi|643711998|gb|KDP25426.1| hypothetical protein JCGZ_20582 [Jatropha curcas] Length = 583 Score = 56.6 bits (135), Expect = 7e-06 Identities = 31/60 (51%), Positives = 35/60 (58%) Frame = -3 Query: 421 NTLDLRMNGGAITFSGGSYALSENFATYNLIGHSNHRADGRLMPCQIPSVADDYLFPK*F 242 NTL L MNGGAI FSGG Y+L E + N G N+R DGRLM + D Y FP F Sbjct: 527 NTLGLTMNGGAIRFSGGGYSLPEPYIANNFHGLPNYRVDGRLM-----TFEDGYRFPNRF 581 >ref|XP_002509813.1| hypothetical protein RCOM_1687010 [Ricinus communis] gi|223549712|gb|EEF51200.1| hypothetical protein RCOM_1687010 [Ricinus communis] Length = 584 Score = 56.6 bits (135), Expect = 7e-06 Identities = 28/46 (60%), Positives = 31/46 (67%) Frame = -3 Query: 421 NTLDLRMNGGAITFSGGSYALSENFATYNLIGHSNHRADGRLMPCQ 284 NTL L MNGGAI FSG Y+L E + N HSN+RADGRLM Q Sbjct: 532 NTLGLSMNGGAIRFSGEGYSLPEPYIANNFHSHSNYRADGRLMTYQ 577