BLASTX nr result
ID: Zanthoxylum22_contig00031423
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00031423 (637 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010653673.1| PREDICTED: uncharacterized protein LOC100267... 80 1e-12 gb|KDO57361.1| hypothetical protein CISIN_1g0105281mg, partial [... 80 1e-12 emb|CBI32858.3| unnamed protein product [Vitis vinifera] 80 1e-12 ref|XP_006481983.1| PREDICTED: uncharacterized protein LOC102612... 80 1e-12 ref|XP_006430439.1| hypothetical protein CICLE_v10011316mg [Citr... 80 1e-12 emb|CAN67369.1| hypothetical protein VITISV_032199 [Vitis vinifera] 80 1e-12 ref|XP_012079612.1| PREDICTED: uncharacterized protein LOC105640... 79 2e-12 ref|XP_014491353.1| PREDICTED: uncharacterized protein LOC106753... 78 4e-12 gb|KOM38658.1| hypothetical protein LR48_Vigan03g204000, partial... 78 4e-12 ref|XP_011016111.1| PREDICTED: uncharacterized protein LOC105118... 77 6e-12 ref|XP_011015657.1| PREDICTED: uncharacterized protein LOC105118... 77 6e-12 ref|XP_011015253.1| PREDICTED: uncharacterized protein LOC105118... 77 6e-12 ref|XP_011014094.1| PREDICTED: uncharacterized protein LOC105117... 77 8e-12 ref|XP_007161836.1| hypothetical protein PHAVU_001G102100g [Phas... 77 8e-12 ref|XP_013449526.1| kinase family protein [Medicago truncatula] ... 77 1e-11 ref|XP_003624792.1| kinase family protein [Medicago truncatula] ... 77 1e-11 gb|KHN34602.1| hypothetical protein glysoja_011155 [Glycine soja] 76 1e-11 emb|CDP14346.1| unnamed protein product [Coffea canephora] 76 1e-11 ref|XP_008240656.1| PREDICTED: uncharacterized protein LOC103339... 76 1e-11 ref|XP_006604288.1| PREDICTED: uncharacterized protein LOC100801... 76 1e-11 >ref|XP_010653673.1| PREDICTED: uncharacterized protein LOC100267097 [Vitis vinifera] Length = 702 Score = 80.1 bits (196), Expect = 1e-12 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = -3 Query: 635 DYGDSLCGTPYPIDYEIWLRRLRRNVHEEDHGKEIDT 525 DY DSLCGTPYP+DY+IWLRRLRRN+HEEDHGKEIDT Sbjct: 664 DYVDSLCGTPYPMDYDIWLRRLRRNIHEEDHGKEIDT 700 >gb|KDO57361.1| hypothetical protein CISIN_1g0105281mg, partial [Citrus sinensis] Length = 420 Score = 80.1 bits (196), Expect = 1e-12 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = -3 Query: 635 DYGDSLCGTPYPIDYEIWLRRLRRNVHEEDHGKEIDT 525 DY DSLCGTPYPIDY+IWLRRLR+N+HEEDHGKEIDT Sbjct: 382 DYVDSLCGTPYPIDYDIWLRRLRKNIHEEDHGKEIDT 418 >emb|CBI32858.3| unnamed protein product [Vitis vinifera] Length = 535 Score = 80.1 bits (196), Expect = 1e-12 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = -3 Query: 635 DYGDSLCGTPYPIDYEIWLRRLRRNVHEEDHGKEIDT 525 DY DSLCGTPYP+DY+IWLRRLRRN+HEEDHGKEIDT Sbjct: 497 DYVDSLCGTPYPMDYDIWLRRLRRNIHEEDHGKEIDT 533 >ref|XP_006481983.1| PREDICTED: uncharacterized protein LOC102612076 [Citrus sinensis] Length = 698 Score = 80.1 bits (196), Expect = 1e-12 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = -3 Query: 635 DYGDSLCGTPYPIDYEIWLRRLRRNVHEEDHGKEIDT 525 DY DSLCGTPYPIDY+IWLRRLR+N+HEEDHGKEIDT Sbjct: 660 DYVDSLCGTPYPIDYDIWLRRLRKNIHEEDHGKEIDT 696 >ref|XP_006430439.1| hypothetical protein CICLE_v10011316mg [Citrus clementina] gi|557532496|gb|ESR43679.1| hypothetical protein CICLE_v10011316mg [Citrus clementina] Length = 608 Score = 80.1 bits (196), Expect = 1e-12 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = -3 Query: 635 DYGDSLCGTPYPIDYEIWLRRLRRNVHEEDHGKEIDT 525 DY DSLCGTPYPIDY+IWLRRLR+N+HEEDHGKEIDT Sbjct: 570 DYVDSLCGTPYPIDYDIWLRRLRKNIHEEDHGKEIDT 606 >emb|CAN67369.1| hypothetical protein VITISV_032199 [Vitis vinifera] Length = 683 Score = 80.1 bits (196), Expect = 1e-12 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = -3 Query: 635 DYGDSLCGTPYPIDYEIWLRRLRRNVHEEDHGKEIDT 525 DY DSLCGTPYP+DY+IWLRRLRRN+HEEDHGKEIDT Sbjct: 645 DYVDSLCGTPYPMDYDIWLRRLRRNIHEEDHGKEIDT 681 >ref|XP_012079612.1| PREDICTED: uncharacterized protein LOC105640019 [Jatropha curcas] gi|643721791|gb|KDP31730.1| hypothetical protein JCGZ_14887 [Jatropha curcas] Length = 699 Score = 79.0 bits (193), Expect = 2e-12 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = -3 Query: 635 DYGDSLCGTPYPIDYEIWLRRLRRNVHEEDHGKEIDT 525 DY DSLCGTPYPIDY+IWLRRLRRN+H++DHGKEIDT Sbjct: 661 DYVDSLCGTPYPIDYDIWLRRLRRNIHDDDHGKEIDT 697 >ref|XP_014491353.1| PREDICTED: uncharacterized protein LOC106753962 [Vigna radiata var. radiata] Length = 696 Score = 78.2 bits (191), Expect = 4e-12 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -3 Query: 635 DYGDSLCGTPYPIDYEIWLRRLRRNVHEEDHGKEID 528 DY DSLCGTPYP+DYEIWLRRLRRN+HE+DHGKEID Sbjct: 658 DYVDSLCGTPYPMDYEIWLRRLRRNIHEDDHGKEID 693 >gb|KOM38658.1| hypothetical protein LR48_Vigan03g204000, partial [Vigna angularis] Length = 663 Score = 78.2 bits (191), Expect = 4e-12 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -3 Query: 635 DYGDSLCGTPYPIDYEIWLRRLRRNVHEEDHGKEID 528 DY DSLCGTPYP+DYEIWLRRLRRN+HE+DHGKEID Sbjct: 625 DYVDSLCGTPYPMDYEIWLRRLRRNIHEDDHGKEID 660 >ref|XP_011016111.1| PREDICTED: uncharacterized protein LOC105118863 isoform X3 [Populus euphratica] Length = 712 Score = 77.4 bits (189), Expect = 6e-12 Identities = 30/37 (81%), Positives = 36/37 (97%) Frame = -3 Query: 635 DYGDSLCGTPYPIDYEIWLRRLRRNVHEEDHGKEIDT 525 DY DSLCGTPYPIDY+IWLRRLRRN+H++DHGK++DT Sbjct: 674 DYVDSLCGTPYPIDYDIWLRRLRRNIHDDDHGKQVDT 710 >ref|XP_011015657.1| PREDICTED: uncharacterized protein LOC105118863 isoform X2 [Populus euphratica] gi|743782284|ref|XP_011015717.1| PREDICTED: uncharacterized protein LOC105118863 isoform X2 [Populus euphratica] gi|743782288|ref|XP_011015782.1| PREDICTED: uncharacterized protein LOC105118863 isoform X2 [Populus euphratica] gi|743782292|ref|XP_011015850.1| PREDICTED: uncharacterized protein LOC105118863 isoform X2 [Populus euphratica] gi|743782296|ref|XP_011015917.1| PREDICTED: uncharacterized protein LOC105118863 isoform X2 [Populus euphratica] gi|743782300|ref|XP_011015977.1| PREDICTED: uncharacterized protein LOC105118863 isoform X2 [Populus euphratica] gi|743782304|ref|XP_011016040.1| PREDICTED: uncharacterized protein LOC105118863 isoform X2 [Populus euphratica] Length = 760 Score = 77.4 bits (189), Expect = 6e-12 Identities = 30/37 (81%), Positives = 36/37 (97%) Frame = -3 Query: 635 DYGDSLCGTPYPIDYEIWLRRLRRNVHEEDHGKEIDT 525 DY DSLCGTPYPIDY+IWLRRLRRN+H++DHGK++DT Sbjct: 722 DYVDSLCGTPYPIDYDIWLRRLRRNIHDDDHGKQVDT 758 >ref|XP_011015253.1| PREDICTED: uncharacterized protein LOC105118863 isoform X1 [Populus euphratica] gi|743782254|ref|XP_011015317.1| PREDICTED: uncharacterized protein LOC105118863 isoform X1 [Populus euphratica] gi|743782257|ref|XP_011015397.1| PREDICTED: uncharacterized protein LOC105118863 isoform X1 [Populus euphratica] gi|743782260|ref|XP_011015467.1| PREDICTED: uncharacterized protein LOC105118863 isoform X1 [Populus euphratica] gi|743782264|ref|XP_011015523.1| PREDICTED: uncharacterized protein LOC105118863 isoform X1 [Populus euphratica] gi|743782267|ref|XP_011015592.1| PREDICTED: uncharacterized protein LOC105118863 isoform X1 [Populus euphratica] Length = 770 Score = 77.4 bits (189), Expect = 6e-12 Identities = 30/37 (81%), Positives = 36/37 (97%) Frame = -3 Query: 635 DYGDSLCGTPYPIDYEIWLRRLRRNVHEEDHGKEIDT 525 DY DSLCGTPYPIDY+IWLRRLRRN+H++DHGK++DT Sbjct: 732 DYVDSLCGTPYPIDYDIWLRRLRRNIHDDDHGKQVDT 768 >ref|XP_011014094.1| PREDICTED: uncharacterized protein LOC105117964 [Populus euphratica] gi|743801227|ref|XP_011014102.1| PREDICTED: uncharacterized protein LOC105117964 [Populus euphratica] gi|743801231|ref|XP_011014108.1| PREDICTED: uncharacterized protein LOC105117964 [Populus euphratica] Length = 772 Score = 77.0 bits (188), Expect = 8e-12 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = -3 Query: 635 DYGDSLCGTPYPIDYEIWLRRLRRNVHEEDHGKEIDT 525 DY DSLCGTPYPIDY+IWLRRLRRN+H+ DHGKE+DT Sbjct: 734 DYVDSLCGTPYPIDYDIWLRRLRRNIHDGDHGKEVDT 770 >ref|XP_007161836.1| hypothetical protein PHAVU_001G102100g [Phaseolus vulgaris] gi|561035300|gb|ESW33830.1| hypothetical protein PHAVU_001G102100g [Phaseolus vulgaris] Length = 696 Score = 77.0 bits (188), Expect = 8e-12 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = -3 Query: 635 DYGDSLCGTPYPIDYEIWLRRLRRNVHEEDHGKEID 528 DY DSLCGTPYP+DY+IWLRRLRRN+HE+DHGKEID Sbjct: 658 DYVDSLCGTPYPMDYDIWLRRLRRNIHEDDHGKEID 693 >ref|XP_013449526.1| kinase family protein [Medicago truncatula] gi|657379056|gb|KEH23554.1| kinase family protein [Medicago truncatula] Length = 609 Score = 76.6 bits (187), Expect = 1e-11 Identities = 31/37 (83%), Positives = 36/37 (97%) Frame = -3 Query: 635 DYGDSLCGTPYPIDYEIWLRRLRRNVHEEDHGKEIDT 525 DY DSLCGTPYPI+Y+IWLRRLRRN+HE+DHGKEID+ Sbjct: 571 DYVDSLCGTPYPINYDIWLRRLRRNIHEDDHGKEIDS 607 >ref|XP_003624792.1| kinase family protein [Medicago truncatula] gi|355499807|gb|AES81010.1| kinase family protein [Medicago truncatula] Length = 699 Score = 76.6 bits (187), Expect = 1e-11 Identities = 31/37 (83%), Positives = 36/37 (97%) Frame = -3 Query: 635 DYGDSLCGTPYPIDYEIWLRRLRRNVHEEDHGKEIDT 525 DY DSLCGTPYPI+Y+IWLRRLRRN+HE+DHGKEID+ Sbjct: 661 DYVDSLCGTPYPINYDIWLRRLRRNIHEDDHGKEIDS 697 >gb|KHN34602.1| hypothetical protein glysoja_011155 [Glycine soja] Length = 503 Score = 76.3 bits (186), Expect = 1e-11 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = -3 Query: 635 DYGDSLCGTPYPIDYEIWLRRLRRNVHEEDHGKEID 528 DY DSLCGTPYPIDY+IWLRRLRR++HE+DHGKEID Sbjct: 465 DYVDSLCGTPYPIDYDIWLRRLRRSIHEDDHGKEID 500 >emb|CDP14346.1| unnamed protein product [Coffea canephora] Length = 609 Score = 76.3 bits (186), Expect = 1e-11 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = -3 Query: 635 DYGDSLCGTPYPIDYEIWLRRLRRNVHEEDHGKEID 528 DY DSLCGTPYP+DY+IWLRRLRR++HEEDHGKEID Sbjct: 571 DYVDSLCGTPYPMDYDIWLRRLRRHIHEEDHGKEID 606 >ref|XP_008240656.1| PREDICTED: uncharacterized protein LOC103339144 [Prunus mume] Length = 698 Score = 76.3 bits (186), Expect = 1e-11 Identities = 31/37 (83%), Positives = 36/37 (97%) Frame = -3 Query: 635 DYGDSLCGTPYPIDYEIWLRRLRRNVHEEDHGKEIDT 525 DY DSLCGTPYP+DY+IWLRRLRRN++E+DHGKEIDT Sbjct: 660 DYVDSLCGTPYPMDYDIWLRRLRRNINEDDHGKEIDT 696 >ref|XP_006604288.1| PREDICTED: uncharacterized protein LOC100801137 isoform X2 [Glycine max] gi|947045337|gb|KRG94966.1| hypothetical protein GLYMA_19G121400 [Glycine max] Length = 697 Score = 76.3 bits (186), Expect = 1e-11 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = -3 Query: 635 DYGDSLCGTPYPIDYEIWLRRLRRNVHEEDHGKEID 528 DY DSLCGTPYPIDY+IWLRRLRR++HE+DHGKEID Sbjct: 659 DYVDSLCGTPYPIDYDIWLRRLRRSIHEDDHGKEID 694