BLASTX nr result
ID: Zanthoxylum22_contig00031214
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00031214 (342 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006444735.1| hypothetical protein CICLE_v10021586mg [Citr... 65 2e-08 >ref|XP_006444735.1| hypothetical protein CICLE_v10021586mg [Citrus clementina] gi|568876592|ref|XP_006491361.1| PREDICTED: RNA-binding protein 24-like [Citrus sinensis] gi|557546997|gb|ESR57975.1| hypothetical protein CICLE_v10021586mg [Citrus clementina] gi|641867916|gb|KDO86600.1| hypothetical protein CISIN_1g023688mg [Citrus sinensis] Length = 278 Score = 65.1 bits (157), Expect = 2e-08 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -2 Query: 341 GFGVQYPQMLQYGSYLPHHYGTPGILSPPTSMP 243 GFGV YPQMLQYG +LPHHYGT GILS PTSMP Sbjct: 210 GFGVHYPQMLQYGPFLPHHYGTAGILSLPTSMP 242