BLASTX nr result
ID: Zanthoxylum22_contig00031138
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00031138 (402 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_007516908.1| hypothetical protein GlmaxMp59 (mitochondrio... 65 2e-08 ref|XP_013442839.1| hypothetical protein MTR_0082s0250 [Medicago... 58 3e-06 >ref|YP_007516908.1| hypothetical protein GlmaxMp59 (mitochondrion) [Glycine max] gi|403311617|gb|AFR34365.1| hypothetical protein GlmaxMp59 (mitochondrion) [Glycine max] Length = 107 Score = 65.1 bits (157), Expect = 2e-08 Identities = 33/46 (71%), Positives = 37/46 (80%) Frame = +3 Query: 153 EVFSDLPLRKVSSRQLN*PGKLLGAPHGLVKGRGKR*LLHPGVHFI 290 EVFSDLPLRKVSSRQLN PGKL+GAPHGLV GRG+ + + FI Sbjct: 60 EVFSDLPLRKVSSRQLNLPGKLVGAPHGLVIGRGECLFIRGFISFI 105 >ref|XP_013442839.1| hypothetical protein MTR_0082s0250 [Medicago truncatula] gi|657370803|gb|KEH16864.1| hypothetical protein MTR_0082s0250 [Medicago truncatula] Length = 96 Score = 57.8 bits (138), Expect = 3e-06 Identities = 29/45 (64%), Positives = 33/45 (73%), Gaps = 2/45 (4%) Frame = +1 Query: 46 FQRNESIK--LFACCPLTLPCGGLSGVYGRSDLSRDEEKSFPIFH 174 F+ ES+ L + +LPCGGLSGVYG SD SRDEEKSFPIFH Sbjct: 52 FKGRESVTACLLSSNSFSLPCGGLSGVYGGSDQSRDEEKSFPIFH 96