BLASTX nr result
ID: Zanthoxylum22_contig00031091
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00031091 (428 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO40070.1| hypothetical protein CISIN_1g0182082mg, partial [... 75 2e-11 gb|KDO40069.1| hypothetical protein CISIN_1g0182082mg, partial [... 75 2e-11 ref|XP_006432587.1| hypothetical protein CICLE_v10001613mg [Citr... 75 2e-11 ref|XP_006432586.1| hypothetical protein CICLE_v10001613mg [Citr... 75 2e-11 >gb|KDO40070.1| hypothetical protein CISIN_1g0182082mg, partial [Citrus sinensis] Length = 164 Score = 74.7 bits (182), Expect = 2e-11 Identities = 38/51 (74%), Positives = 42/51 (82%) Frame = -2 Query: 427 IDFGCYLNDQRANKNPLSRTQLSMSTPLASSEFFERSVLSSKDNSRDKFQS 275 IDFG YL+DQRANK+ LS TQLSMSTP+ASS+FFE S SSKD S DKF S Sbjct: 114 IDFGYYLDDQRANKSSLSTTQLSMSTPIASSKFFETSAHSSKDTSMDKFLS 164 >gb|KDO40069.1| hypothetical protein CISIN_1g0182082mg, partial [Citrus sinensis] Length = 168 Score = 74.7 bits (182), Expect = 2e-11 Identities = 38/51 (74%), Positives = 42/51 (82%) Frame = -2 Query: 427 IDFGCYLNDQRANKNPLSRTQLSMSTPLASSEFFERSVLSSKDNSRDKFQS 275 IDFG YL+DQRANK+ LS TQLSMSTP+ASS+FFE S SSKD S DKF S Sbjct: 118 IDFGYYLDDQRANKSSLSTTQLSMSTPIASSKFFETSAHSSKDTSMDKFLS 168 >ref|XP_006432587.1| hypothetical protein CICLE_v10001613mg [Citrus clementina] gi|568881561|ref|XP_006493632.1| PREDICTED: growth-regulating factor 4-like isoform X2 [Citrus sinensis] gi|557534709|gb|ESR45827.1| hypothetical protein CICLE_v10001613mg [Citrus clementina] Length = 357 Score = 74.7 bits (182), Expect = 2e-11 Identities = 38/51 (74%), Positives = 42/51 (82%) Frame = -2 Query: 427 IDFGCYLNDQRANKNPLSRTQLSMSTPLASSEFFERSVLSSKDNSRDKFQS 275 IDFG YL+DQRANK+ LS TQLSMSTP+ASS+FFE S SSKD S DKF S Sbjct: 307 IDFGYYLDDQRANKSSLSTTQLSMSTPIASSKFFETSAHSSKDTSMDKFLS 357 >ref|XP_006432586.1| hypothetical protein CICLE_v10001613mg [Citrus clementina] gi|568881559|ref|XP_006493631.1| PREDICTED: growth-regulating factor 4-like isoform X1 [Citrus sinensis] gi|557534708|gb|ESR45826.1| hypothetical protein CICLE_v10001613mg [Citrus clementina] Length = 361 Score = 74.7 bits (182), Expect = 2e-11 Identities = 38/51 (74%), Positives = 42/51 (82%) Frame = -2 Query: 427 IDFGCYLNDQRANKNPLSRTQLSMSTPLASSEFFERSVLSSKDNSRDKFQS 275 IDFG YL+DQRANK+ LS TQLSMSTP+ASS+FFE S SSKD S DKF S Sbjct: 311 IDFGYYLDDQRANKSSLSTTQLSMSTPIASSKFFETSAHSSKDTSMDKFLS 361