BLASTX nr result
ID: Zanthoxylum22_contig00030479
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00030479 (203 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006480338.1| PREDICTED: transcription factor MYB86-like [... 65 2e-08 ref|XP_006423960.1| hypothetical protein CICLE_v10028398mg [Citr... 65 2e-08 >ref|XP_006480338.1| PREDICTED: transcription factor MYB86-like [Citrus sinensis] gi|641837438|gb|KDO56392.1| hypothetical protein CISIN_1g014135mg [Citrus sinensis] Length = 430 Score = 65.5 bits (158), Expect = 2e-08 Identities = 40/49 (81%), Positives = 42/49 (85%), Gaps = 3/49 (6%) Frame = -1 Query: 203 HKPLSEVEND-EKQLTG-NKNNDKAPAES-KDLAAEIMHSLEVSSGSEI 66 HKPLSEVEND E+QLT NKN+DKA AES KDLAAEIMH LEVSS SEI Sbjct: 126 HKPLSEVENDKEQQLTVINKNSDKASAESSKDLAAEIMHPLEVSSSSEI 174 >ref|XP_006423960.1| hypothetical protein CICLE_v10028398mg [Citrus clementina] gi|557525894|gb|ESR37200.1| hypothetical protein CICLE_v10028398mg [Citrus clementina] Length = 458 Score = 65.5 bits (158), Expect = 2e-08 Identities = 40/49 (81%), Positives = 42/49 (85%), Gaps = 3/49 (6%) Frame = -1 Query: 203 HKPLSEVEND-EKQLTG-NKNNDKAPAES-KDLAAEIMHSLEVSSGSEI 66 HKPLSEVEND E+QLT NKN+DKA AES KDLAAEIMH LEVSS SEI Sbjct: 154 HKPLSEVENDKEQQLTVINKNSDKASAESSKDLAAEIMHPLEVSSSSEI 202