BLASTX nr result
ID: Zanthoxylum22_contig00030477
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00030477 (398 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006469053.1| PREDICTED: pentatricopeptide repeat-containi... 77 4e-12 ref|XP_006446741.1| hypothetical protein CICLE_v10017507mg [Citr... 77 4e-12 ref|XP_010099503.1| hypothetical protein L484_001451 [Morus nota... 75 1e-11 ref|XP_012079032.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 72 2e-10 gb|KDP31766.1| hypothetical protein JCGZ_12227 [Jatropha curcas] 72 2e-10 ref|XP_002278909.1| PREDICTED: pentatricopeptide repeat-containi... 72 2e-10 ref|XP_008229126.1| PREDICTED: pentatricopeptide repeat-containi... 70 6e-10 ref|XP_007214673.1| hypothetical protein PRUPE_ppa021626mg [Prun... 70 6e-10 ref|XP_011037416.1| PREDICTED: pentatricopeptide repeat-containi... 69 1e-09 ref|XP_011469558.1| PREDICTED: pentatricopeptide repeat-containi... 69 1e-09 ref|XP_004487183.1| PREDICTED: pentatricopeptide repeat-containi... 69 2e-09 gb|KNA06286.1| hypothetical protein SOVF_182560, partial [Spinac... 68 2e-09 ref|XP_006376410.1| pentatricopeptide repeat-containing family p... 68 2e-09 ref|XP_010522113.1| PREDICTED: pentatricopeptide repeat-containi... 68 3e-09 ref|XP_013583920.1| PREDICTED: pentatricopeptide repeat-containi... 67 4e-09 ref|XP_013465185.1| PPR containing plant-like protein [Medicago ... 67 5e-09 gb|KHN27922.1| Pentatricopeptide repeat-containing protein, part... 67 7e-09 ref|XP_009119070.1| PREDICTED: pentatricopeptide repeat-containi... 67 7e-09 ref|XP_013723211.1| PREDICTED: pentatricopeptide repeat-containi... 67 7e-09 ref|XP_003540386.1| PREDICTED: pentatricopeptide repeat-containi... 67 7e-09 >ref|XP_006469053.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06270-like [Citrus sinensis] gi|641826551|gb|KDO45768.1| hypothetical protein CISIN_1g046547mg [Citrus sinensis] Length = 343 Score = 77.4 bits (189), Expect = 4e-12 Identities = 38/44 (86%), Positives = 39/44 (88%) Frame = -1 Query: 395 VMGMTETGFIPYIGVRHKVVGGLAGIGEWKLACVVRQRFAELKS 264 VMGMTE GFIPYI VR KVV GLAG+GEWKLA VVRQRFAELKS Sbjct: 300 VMGMTERGFIPYIKVRQKVVEGLAGVGEWKLATVVRQRFAELKS 343 >ref|XP_006446741.1| hypothetical protein CICLE_v10017507mg [Citrus clementina] gi|557549352|gb|ESR59981.1| hypothetical protein CICLE_v10017507mg [Citrus clementina] Length = 343 Score = 77.4 bits (189), Expect = 4e-12 Identities = 38/44 (86%), Positives = 39/44 (88%) Frame = -1 Query: 395 VMGMTETGFIPYIGVRHKVVGGLAGIGEWKLACVVRQRFAELKS 264 VMGMTE GFIPYI VR KVV GLAG+GEWKLA VVRQRFAELKS Sbjct: 300 VMGMTERGFIPYIKVRQKVVEGLAGVGEWKLASVVRQRFAELKS 343 >ref|XP_010099503.1| hypothetical protein L484_001451 [Morus notabilis] gi|587890358|gb|EXB79007.1| hypothetical protein L484_001451 [Morus notabilis] Length = 344 Score = 75.5 bits (184), Expect = 1e-11 Identities = 35/44 (79%), Positives = 38/44 (86%) Frame = -1 Query: 395 VMGMTETGFIPYIGVRHKVVGGLAGIGEWKLACVVRQRFAELKS 264 VMGMTE GF+PYIGVR K+V LAGIGEWKLAC VRQRF EL+S Sbjct: 301 VMGMTEKGFLPYIGVRQKLVERLAGIGEWKLACAVRQRFVELRS 344 >ref|XP_012079032.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At1g06270 [Jatropha curcas] Length = 338 Score = 71.6 bits (174), Expect = 2e-10 Identities = 34/43 (79%), Positives = 35/43 (81%) Frame = -1 Query: 392 MGMTETGFIPYIGVRHKVVGGLAGIGEWKLACVVRQRFAELKS 264 +GMTE GFIPYI VR KVV GLAG GEWKLAC VRQRF EL S Sbjct: 296 IGMTEKGFIPYIKVRQKVVEGLAGAGEWKLACAVRQRFTELSS 338 >gb|KDP31766.1| hypothetical protein JCGZ_12227 [Jatropha curcas] Length = 182 Score = 71.6 bits (174), Expect = 2e-10 Identities = 34/43 (79%), Positives = 35/43 (81%) Frame = -1 Query: 392 MGMTETGFIPYIGVRHKVVGGLAGIGEWKLACVVRQRFAELKS 264 +GMTE GFIPYI VR KVV GLAG GEWKLAC VRQRF EL S Sbjct: 140 IGMTEKGFIPYIKVRQKVVEGLAGAGEWKLACAVRQRFTELSS 182 >ref|XP_002278909.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06270 [Vitis vinifera] gi|731408912|ref|XP_010657014.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06270 [Vitis vinifera] gi|731408914|ref|XP_010657015.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06270 [Vitis vinifera] gi|731408916|ref|XP_010657016.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06270 [Vitis vinifera] gi|731408919|ref|XP_010657017.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06270 [Vitis vinifera] gi|302143379|emb|CBI21940.3| unnamed protein product [Vitis vinifera] Length = 343 Score = 71.6 bits (174), Expect = 2e-10 Identities = 34/44 (77%), Positives = 37/44 (84%) Frame = -1 Query: 395 VMGMTETGFIPYIGVRHKVVGGLAGIGEWKLACVVRQRFAELKS 264 VMGMT GFIPYIGVR KVV GLA +GEWKLA VRQRFA+L+S Sbjct: 300 VMGMTARGFIPYIGVRQKVVEGLANLGEWKLALAVRQRFADLRS 343 >ref|XP_008229126.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06270 [Prunus mume] Length = 343 Score = 70.1 bits (170), Expect = 6e-10 Identities = 34/44 (77%), Positives = 35/44 (79%) Frame = -1 Query: 395 VMGMTETGFIPYIGVRHKVVGGLAGIGEWKLACVVRQRFAELKS 264 VMGMTE GFIPYI R KVV LAG GEWKLAC VRQRF EL+S Sbjct: 300 VMGMTERGFIPYIRTRQKVVERLAGAGEWKLACSVRQRFGELRS 343 >ref|XP_007214673.1| hypothetical protein PRUPE_ppa021626mg [Prunus persica] gi|462410538|gb|EMJ15872.1| hypothetical protein PRUPE_ppa021626mg [Prunus persica] Length = 343 Score = 70.1 bits (170), Expect = 6e-10 Identities = 34/44 (77%), Positives = 35/44 (79%) Frame = -1 Query: 395 VMGMTETGFIPYIGVRHKVVGGLAGIGEWKLACVVRQRFAELKS 264 VMGMTE GFIPYI R KVV LAG GEWKLAC VRQRF EL+S Sbjct: 300 VMGMTERGFIPYIRTRQKVVERLAGAGEWKLACSVRQRFGELRS 343 >ref|XP_011037416.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06270 [Populus euphratica] gi|743884958|ref|XP_011037417.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06270 [Populus euphratica] gi|743884962|ref|XP_011037418.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06270 [Populus euphratica] gi|743884966|ref|XP_011037419.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06270 [Populus euphratica] gi|743884970|ref|XP_011037420.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06270 [Populus euphratica] Length = 341 Score = 69.3 bits (168), Expect = 1e-09 Identities = 32/44 (72%), Positives = 35/44 (79%) Frame = -1 Query: 395 VMGMTETGFIPYIGVRHKVVGGLAGIGEWKLACVVRQRFAELKS 264 VMGMTE GFIPYI VR KV+ GL +GEWKLAC VR+RFA L S Sbjct: 298 VMGMTEKGFIPYIKVRQKVIEGLIDVGEWKLACTVRERFAALSS 341 >ref|XP_011469558.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06270 [Fragaria vesca subsp. vesca] Length = 341 Score = 69.3 bits (168), Expect = 1e-09 Identities = 33/44 (75%), Positives = 36/44 (81%) Frame = -1 Query: 395 VMGMTETGFIPYIGVRHKVVGGLAGIGEWKLACVVRQRFAELKS 264 VMGMTE GF+PYI RHKVV LAG GEWKLA VRQRF+EL+S Sbjct: 298 VMGMTEKGFVPYIRTRHKVVERLAGAGEWKLANAVRQRFSELRS 341 >ref|XP_004487183.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06270 [Cicer arietinum] gi|502082497|ref|XP_004487184.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06270 [Cicer arietinum] Length = 338 Score = 68.6 bits (166), Expect = 2e-09 Identities = 31/43 (72%), Positives = 34/43 (79%) Frame = -1 Query: 392 MGMTETGFIPYIGVRHKVVGGLAGIGEWKLACVVRQRFAELKS 264 MGMTE GFIPYI R K++ GLA I EWK+AC VRQRFA LKS Sbjct: 296 MGMTERGFIPYIKARQKIIDGLASIDEWKIACAVRQRFATLKS 338 >gb|KNA06286.1| hypothetical protein SOVF_182560, partial [Spinacia oleracea] Length = 311 Score = 68.2 bits (165), Expect = 2e-09 Identities = 33/43 (76%), Positives = 35/43 (81%) Frame = -1 Query: 392 MGMTETGFIPYIGVRHKVVGGLAGIGEWKLACVVRQRFAELKS 264 M MTE G+IPYI VR KVV GLAG+ EWKLACVVR RFAEL S Sbjct: 269 MLMTEKGYIPYIKVRQKVVEGLAGVDEWKLACVVRHRFAELNS 311 >ref|XP_006376410.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550325686|gb|ERP54207.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 341 Score = 68.2 bits (165), Expect = 2e-09 Identities = 33/44 (75%), Positives = 34/44 (77%) Frame = -1 Query: 395 VMGMTETGFIPYIGVRHKVVGGLAGIGEWKLACVVRQRFAELKS 264 VMGMTE GFIPYI VR KVV GL GEWKLAC VR+RFA L S Sbjct: 298 VMGMTEKGFIPYIKVRQKVVEGLIDAGEWKLACTVRERFAALSS 341 >ref|XP_010522113.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06270 [Tarenaya hassleriana] Length = 338 Score = 67.8 bits (164), Expect = 3e-09 Identities = 33/45 (73%), Positives = 36/45 (80%) Frame = -1 Query: 398 AVMGMTETGFIPYIGVRHKVVGGLAGIGEWKLACVVRQRFAELKS 264 AV+ MTE GFIPYI VR KVV GL IGEWKLAC VRQR AEL++ Sbjct: 294 AVIKMTERGFIPYIRVRQKVVEGLNSIGEWKLACTVRQRLAELRT 338 >ref|XP_013583920.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06270 [Brassica oleracea var. oleracea] gi|922487285|ref|XP_013583921.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06270 [Brassica oleracea var. oleracea] Length = 341 Score = 67.4 bits (163), Expect = 4e-09 Identities = 33/44 (75%), Positives = 35/44 (79%) Frame = -1 Query: 395 VMGMTETGFIPYIGVRHKVVGGLAGIGEWKLACVVRQRFAELKS 264 VM MT+ GFIPYI VR KVV L IGEWKLAC+VRQR AELKS Sbjct: 298 VMRMTDKGFIPYIKVRQKVVERLISIGEWKLACIVRQRLAELKS 341 >ref|XP_013465185.1| PPR containing plant-like protein [Medicago truncatula] gi|657399833|gb|KEH39220.1| PPR containing plant-like protein [Medicago truncatula] Length = 354 Score = 67.0 bits (162), Expect = 5e-09 Identities = 31/43 (72%), Positives = 34/43 (79%) Frame = -1 Query: 392 MGMTETGFIPYIGVRHKVVGGLAGIGEWKLACVVRQRFAELKS 264 MGMTE GFIPYI R K++ GLA I EWK+AC VRQRFA LKS Sbjct: 312 MGMTERGFIPYIKARQKIIEGLASIDEWKIACGVRQRFATLKS 354 >gb|KHN27922.1| Pentatricopeptide repeat-containing protein, partial [Glycine soja] Length = 295 Score = 66.6 bits (161), Expect = 7e-09 Identities = 31/42 (73%), Positives = 33/42 (78%) Frame = -1 Query: 389 GMTETGFIPYIGVRHKVVGGLAGIGEWKLACVVRQRFAELKS 264 GMTE GFIPYI VR K++ GLA I EW LAC VRQRFA LKS Sbjct: 254 GMTERGFIPYIRVRQKIIEGLASIDEWNLACAVRQRFAALKS 295 >ref|XP_009119070.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06270 [Brassica rapa] Length = 342 Score = 66.6 bits (161), Expect = 7e-09 Identities = 32/44 (72%), Positives = 35/44 (79%) Frame = -1 Query: 395 VMGMTETGFIPYIGVRHKVVGGLAGIGEWKLACVVRQRFAELKS 264 VM MT+ GFIPYI VR KVV L GIGEWKLAC VRQR AE++S Sbjct: 299 VMRMTDKGFIPYIKVRQKVVERLIGIGEWKLACTVRQRLAEMRS 342 >ref|XP_013723211.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06270-like [Brassica napus] gi|674875173|emb|CDY57815.1| BnaA10g28040D [Brassica napus] Length = 342 Score = 66.6 bits (161), Expect = 7e-09 Identities = 32/44 (72%), Positives = 35/44 (79%) Frame = -1 Query: 395 VMGMTETGFIPYIGVRHKVVGGLAGIGEWKLACVVRQRFAELKS 264 VM MT+ GFIPYI VR KVV L GIGEWKLAC VRQR AE++S Sbjct: 299 VMRMTDKGFIPYIKVRQKVVERLIGIGEWKLACTVRQRLAEMRS 342 >ref|XP_003540386.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06270-like isoform X1 [Glycine max] gi|947078170|gb|KRH27010.1| hypothetical protein GLYMA_12G208100 [Glycine max] Length = 342 Score = 66.6 bits (161), Expect = 7e-09 Identities = 31/42 (73%), Positives = 33/42 (78%) Frame = -1 Query: 389 GMTETGFIPYIGVRHKVVGGLAGIGEWKLACVVRQRFAELKS 264 GMTE GFIPYI VR K++ GLA I EW LAC VRQRFA LKS Sbjct: 301 GMTERGFIPYIRVRQKIIEGLASIDEWNLACAVRQRFAALKS 342