BLASTX nr result
ID: Zanthoxylum22_contig00030461
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00030461 (482 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006492852.1| PREDICTED: nudix hydrolase 23, chloroplastic... 89 1e-15 gb|KDO70914.1| hypothetical protein CISIN_1g022283mg [Citrus sin... 88 3e-15 ref|XP_010524551.1| PREDICTED: nudix hydrolase 23, chloroplastic... 84 4e-14 ref|XP_009369503.1| PREDICTED: LOW QUALITY PROTEIN: nudix hydrol... 82 2e-13 ref|XP_013634087.1| PREDICTED: nudix hydrolase 23, chloroplastic... 81 3e-13 emb|CDY65801.1| BnaC04g52450D [Brassica napus] 81 3e-13 gb|AAM65373.1| unknown [Arabidopsis thaliana] 81 3e-13 ref|NP_565965.1| nudix hydrolase 23 [Arabidopsis thaliana] gi|68... 81 3e-13 ref|XP_002881819.1| hypothetical protein ARALYDRAFT_483292 [Arab... 81 3e-13 ref|XP_013747793.1| PREDICTED: nudix hydrolase 23, chloroplastic... 81 3e-13 ref|XP_009142800.1| PREDICTED: nudix hydrolase 23, chloroplastic... 81 3e-13 emb|CDX79894.1| BnaA05g02620D [Brassica napus] 81 3e-13 ref|XP_010517716.1| PREDICTED: nudix hydrolase 23, chloroplastic... 80 4e-13 ref|XP_010508622.1| PREDICTED: nudix hydrolase 23, chloroplastic... 80 4e-13 ref|XP_010506003.1| PREDICTED: nudix hydrolase 23, chloroplastic... 80 4e-13 ref|XP_006411472.1| hypothetical protein EUTSA_v10017043mg [Eutr... 80 4e-13 ref|XP_013687010.1| PREDICTED: nudix hydrolase 23, chloroplastic... 80 8e-13 ref|XP_008348342.1| PREDICTED: nudix hydrolase 23, chloroplastic... 80 8e-13 ref|XP_008348340.1| PREDICTED: nudix hydrolase 23, chloroplastic... 80 8e-13 ref|XP_008380142.1| PREDICTED: nudix hydrolase 23, chloroplastic... 80 8e-13 >ref|XP_006492852.1| PREDICTED: nudix hydrolase 23, chloroplastic-like isoform X1 [Citrus sinensis] gi|568879839|ref|XP_006492853.1| PREDICTED: nudix hydrolase 23, chloroplastic-like isoform X2 [Citrus sinensis] Length = 299 Score = 89.4 bits (220), Expect = 1e-15 Identities = 44/50 (88%), Positives = 45/50 (90%) Frame = -3 Query: 480 AFSSIFVTLKLYIDDIRTEKLNFHYGTITKRPGSSPSDMCAFSLDYHLQS 331 AFSSI VTL+LYIDDIR KLNFHYGTI KRPGSSPSDM AFSLDYHLQS Sbjct: 250 AFSSISVTLQLYIDDIRMGKLNFHYGTINKRPGSSPSDMRAFSLDYHLQS 299 >gb|KDO70914.1| hypothetical protein CISIN_1g022283mg [Citrus sinensis] Length = 299 Score = 87.8 bits (216), Expect = 3e-15 Identities = 43/50 (86%), Positives = 45/50 (90%) Frame = -3 Query: 480 AFSSIFVTLKLYIDDIRTEKLNFHYGTITKRPGSSPSDMCAFSLDYHLQS 331 AFSSI VTL+L+IDDIR KLNFHYGTI KRPGSSPSDM AFSLDYHLQS Sbjct: 250 AFSSISVTLQLFIDDIRMGKLNFHYGTINKRPGSSPSDMRAFSLDYHLQS 299 >ref|XP_010524551.1| PREDICTED: nudix hydrolase 23, chloroplastic-like [Tarenaya hassleriana] gi|729302429|ref|XP_010524560.1| PREDICTED: nudix hydrolase 23, chloroplastic-like [Tarenaya hassleriana] gi|729302432|ref|XP_010524569.1| PREDICTED: nudix hydrolase 23, chloroplastic-like [Tarenaya hassleriana] Length = 297 Score = 84.0 bits (206), Expect = 4e-14 Identities = 38/50 (76%), Positives = 44/50 (88%) Frame = -3 Query: 480 AFSSIFVTLKLYIDDIRTEKLNFHYGTITKRPGSSPSDMCAFSLDYHLQS 331 AFSSIFVTL LY++D+R K+ FHYGTI KRPGSSPSD+ AF+LDYHLQS Sbjct: 248 AFSSIFVTLNLYLEDVRNGKIKFHYGTINKRPGSSPSDIRAFTLDYHLQS 297 >ref|XP_009369503.1| PREDICTED: LOW QUALITY PROTEIN: nudix hydrolase 23, chloroplastic [Pyrus x bretschneideri] Length = 347 Score = 81.6 bits (200), Expect = 2e-13 Identities = 37/50 (74%), Positives = 45/50 (90%) Frame = -3 Query: 480 AFSSIFVTLKLYIDDIRTEKLNFHYGTITKRPGSSPSDMCAFSLDYHLQS 331 +FSS+ VTLKLYI+DI+ KLNFHYGTI KRPG+SPSD+ A++LDYHLQS Sbjct: 298 SFSSMVVTLKLYIEDIKAGKLNFHYGTINKRPGTSPSDIHAYTLDYHLQS 347 >ref|XP_013634087.1| PREDICTED: nudix hydrolase 23, chloroplastic [Brassica oleracea var. oleracea] Length = 270 Score = 81.3 bits (199), Expect = 3e-13 Identities = 37/49 (75%), Positives = 43/49 (87%) Frame = -3 Query: 480 AFSSIFVTLKLYIDDIRTEKLNFHYGTITKRPGSSPSDMCAFSLDYHLQ 334 AFSSI+VTL LY++D+R K+ FHYGTI KRPGSSPSD+ AFSLDYHLQ Sbjct: 221 AFSSIYVTLNLYLEDLRKGKVKFHYGTINKRPGSSPSDIRAFSLDYHLQ 269 >emb|CDY65801.1| BnaC04g52450D [Brassica napus] Length = 267 Score = 81.3 bits (199), Expect = 3e-13 Identities = 37/49 (75%), Positives = 43/49 (87%) Frame = -3 Query: 480 AFSSIFVTLKLYIDDIRTEKLNFHYGTITKRPGSSPSDMCAFSLDYHLQ 334 AFSSI+VTL LY++D+R K+ FHYGTI KRPGSSPSD+ AFSLDYHLQ Sbjct: 218 AFSSIYVTLNLYLEDLRKGKVKFHYGTINKRPGSSPSDIRAFSLDYHLQ 266 >gb|AAM65373.1| unknown [Arabidopsis thaliana] Length = 280 Score = 81.3 bits (199), Expect = 3e-13 Identities = 37/49 (75%), Positives = 43/49 (87%) Frame = -3 Query: 480 AFSSIFVTLKLYIDDIRTEKLNFHYGTITKRPGSSPSDMCAFSLDYHLQ 334 AFSSI+VTL LY++D++ KL FHYGTI KRPGSSPSD+ AFSLDYHLQ Sbjct: 231 AFSSIYVTLNLYLEDLKKGKLKFHYGTINKRPGSSPSDIRAFSLDYHLQ 279 >ref|NP_565965.1| nudix hydrolase 23 [Arabidopsis thaliana] gi|68565870|sp|P93740.2|NUD23_ARATH RecName: Full=Nudix hydrolase 23, chloroplastic; Short=AtNUDT23; AltName: Full=ADP-ribose pyrophosphatase; AltName: Full=FAD diphosphatase; Flags: Precursor gi|20198322|gb|AAB63537.2| expressed protein [Arabidopsis thaliana] gi|62320524|dbj|BAD95098.1| hypothetical protein [Arabidopsis thaliana] gi|107738412|gb|ABF83693.1| At2g42070 [Arabidopsis thaliana] gi|330254973|gb|AEC10067.1| nudix hydrolase 23 [Arabidopsis thaliana] Length = 280 Score = 81.3 bits (199), Expect = 3e-13 Identities = 37/49 (75%), Positives = 43/49 (87%) Frame = -3 Query: 480 AFSSIFVTLKLYIDDIRTEKLNFHYGTITKRPGSSPSDMCAFSLDYHLQ 334 AFSSI+VTL LY++D++ KL FHYGTI KRPGSSPSD+ AFSLDYHLQ Sbjct: 231 AFSSIYVTLNLYLEDLKKGKLKFHYGTINKRPGSSPSDIRAFSLDYHLQ 279 >ref|XP_002881819.1| hypothetical protein ARALYDRAFT_483292 [Arabidopsis lyrata subsp. lyrata] gi|297327658|gb|EFH58078.1| hypothetical protein ARALYDRAFT_483292 [Arabidopsis lyrata subsp. lyrata] Length = 283 Score = 81.3 bits (199), Expect = 3e-13 Identities = 37/49 (75%), Positives = 43/49 (87%) Frame = -3 Query: 480 AFSSIFVTLKLYIDDIRTEKLNFHYGTITKRPGSSPSDMCAFSLDYHLQ 334 AFSSI+VTL LY++D++ KL FHYGTI KRPGSSPSD+ AFSLDYHLQ Sbjct: 234 AFSSIYVTLNLYLEDLKKGKLKFHYGTINKRPGSSPSDIRAFSLDYHLQ 282 >ref|XP_013747793.1| PREDICTED: nudix hydrolase 23, chloroplastic-like [Brassica napus] gi|923622116|ref|XP_013747794.1| PREDICTED: nudix hydrolase 23, chloroplastic-like [Brassica napus] Length = 267 Score = 80.9 bits (198), Expect = 3e-13 Identities = 36/49 (73%), Positives = 43/49 (87%) Frame = -3 Query: 480 AFSSIFVTLKLYIDDIRTEKLNFHYGTITKRPGSSPSDMCAFSLDYHLQ 334 AFSSI+VTL LY++D++ K+ FHYGTI KRPGSSPSD+ AFSLDYHLQ Sbjct: 218 AFSSIYVTLNLYLEDVKKGKIKFHYGTINKRPGSSPSDIRAFSLDYHLQ 266 >ref|XP_009142800.1| PREDICTED: nudix hydrolase 23, chloroplastic-like [Brassica rapa] Length = 267 Score = 80.9 bits (198), Expect = 3e-13 Identities = 36/49 (73%), Positives = 43/49 (87%) Frame = -3 Query: 480 AFSSIFVTLKLYIDDIRTEKLNFHYGTITKRPGSSPSDMCAFSLDYHLQ 334 AFSSI+VTL LY++D++ K+ FHYGTI KRPGSSPSD+ AFSLDYHLQ Sbjct: 218 AFSSIYVTLNLYLEDVKKGKIKFHYGTINKRPGSSPSDIRAFSLDYHLQ 266 >emb|CDX79894.1| BnaA05g02620D [Brassica napus] Length = 282 Score = 80.9 bits (198), Expect = 3e-13 Identities = 36/49 (73%), Positives = 43/49 (87%) Frame = -3 Query: 480 AFSSIFVTLKLYIDDIRTEKLNFHYGTITKRPGSSPSDMCAFSLDYHLQ 334 AFSSI+VTL LY++D++ K+ FHYGTI KRPGSSPSD+ AFSLDYHLQ Sbjct: 233 AFSSIYVTLNLYLEDVKKGKIKFHYGTINKRPGSSPSDIRAFSLDYHLQ 281 >ref|XP_010517716.1| PREDICTED: nudix hydrolase 23, chloroplastic-like [Camelina sativa] gi|727471519|ref|XP_010517717.1| PREDICTED: nudix hydrolase 23, chloroplastic-like [Camelina sativa] Length = 283 Score = 80.5 bits (197), Expect = 4e-13 Identities = 36/49 (73%), Positives = 43/49 (87%) Frame = -3 Query: 480 AFSSIFVTLKLYIDDIRTEKLNFHYGTITKRPGSSPSDMCAFSLDYHLQ 334 AFSSI+VTL LY++D++ K+ FHYGTI KRPGSSPSD+ AFSLDYHLQ Sbjct: 234 AFSSIYVTLNLYLEDLKNGKVKFHYGTINKRPGSSPSDIRAFSLDYHLQ 282 >ref|XP_010508622.1| PREDICTED: nudix hydrolase 23, chloroplastic-like [Camelina sativa] Length = 283 Score = 80.5 bits (197), Expect = 4e-13 Identities = 36/49 (73%), Positives = 43/49 (87%) Frame = -3 Query: 480 AFSSIFVTLKLYIDDIRTEKLNFHYGTITKRPGSSPSDMCAFSLDYHLQ 334 AFSSI+VTL LY++D++ K+ FHYGTI KRPGSSPSD+ AFSLDYHLQ Sbjct: 234 AFSSIYVTLNLYLEDLKNGKVKFHYGTINKRPGSSPSDIRAFSLDYHLQ 282 >ref|XP_010506003.1| PREDICTED: nudix hydrolase 23, chloroplastic [Camelina sativa] Length = 283 Score = 80.5 bits (197), Expect = 4e-13 Identities = 36/49 (73%), Positives = 43/49 (87%) Frame = -3 Query: 480 AFSSIFVTLKLYIDDIRTEKLNFHYGTITKRPGSSPSDMCAFSLDYHLQ 334 AFSSI+VTL LY++D++ K+ FHYGTI KRPGSSPSD+ AFSLDYHLQ Sbjct: 234 AFSSIYVTLNLYLEDLKNGKVKFHYGTINKRPGSSPSDIRAFSLDYHLQ 282 >ref|XP_006411472.1| hypothetical protein EUTSA_v10017043mg [Eutrema salsugineum] gi|557112641|gb|ESQ52925.1| hypothetical protein EUTSA_v10017043mg [Eutrema salsugineum] Length = 285 Score = 80.5 bits (197), Expect = 4e-13 Identities = 36/49 (73%), Positives = 43/49 (87%) Frame = -3 Query: 480 AFSSIFVTLKLYIDDIRTEKLNFHYGTITKRPGSSPSDMCAFSLDYHLQ 334 AFSSI+VTL LY++D++ KL FHYGTI KRPGSSPSD+ AF+LDYHLQ Sbjct: 236 AFSSIYVTLNLYLEDLKNGKLKFHYGTINKRPGSSPSDIRAFTLDYHLQ 284 >ref|XP_013687010.1| PREDICTED: nudix hydrolase 23, chloroplastic-like [Brassica napus] Length = 270 Score = 79.7 bits (195), Expect = 8e-13 Identities = 36/49 (73%), Positives = 43/49 (87%) Frame = -3 Query: 480 AFSSIFVTLKLYIDDIRTEKLNFHYGTITKRPGSSPSDMCAFSLDYHLQ 334 AFSSI+VTL LY++D+R ++ FHYGTI KRPGSSPSD+ AFSLDYHLQ Sbjct: 221 AFSSIYVTLNLYLEDLRKGEVKFHYGTINKRPGSSPSDIQAFSLDYHLQ 269 >ref|XP_008348342.1| PREDICTED: nudix hydrolase 23, chloroplastic-like isoform X2 [Malus domestica] Length = 337 Score = 79.7 bits (195), Expect = 8e-13 Identities = 35/50 (70%), Positives = 45/50 (90%) Frame = -3 Query: 480 AFSSIFVTLKLYIDDIRTEKLNFHYGTITKRPGSSPSDMCAFSLDYHLQS 331 +FSS+ VTLKLYI+D++ KLNFHYGTI KRPG+SPSD+ A++L+YHLQS Sbjct: 288 SFSSMVVTLKLYIEDVKAGKLNFHYGTINKRPGTSPSDIHAYTLEYHLQS 337 >ref|XP_008348340.1| PREDICTED: nudix hydrolase 23, chloroplastic-like isoform X1 [Malus domestica] gi|658025845|ref|XP_008348341.1| PREDICTED: nudix hydrolase 23, chloroplastic-like isoform X1 [Malus domestica] Length = 347 Score = 79.7 bits (195), Expect = 8e-13 Identities = 35/50 (70%), Positives = 45/50 (90%) Frame = -3 Query: 480 AFSSIFVTLKLYIDDIRTEKLNFHYGTITKRPGSSPSDMCAFSLDYHLQS 331 +FSS+ VTLKLYI+D++ KLNFHYGTI KRPG+SPSD+ A++L+YHLQS Sbjct: 298 SFSSMVVTLKLYIEDVKAGKLNFHYGTINKRPGTSPSDIHAYTLEYHLQS 347 >ref|XP_008380142.1| PREDICTED: nudix hydrolase 23, chloroplastic isoform X3 [Malus domestica] gi|658025849|ref|XP_008348343.1| PREDICTED: nudix hydrolase 23, chloroplastic-like isoform X3 [Malus domestica] Length = 297 Score = 79.7 bits (195), Expect = 8e-13 Identities = 35/50 (70%), Positives = 45/50 (90%) Frame = -3 Query: 480 AFSSIFVTLKLYIDDIRTEKLNFHYGTITKRPGSSPSDMCAFSLDYHLQS 331 +FSS+ VTLKLYI+D++ KLNFHYGTI KRPG+SPSD+ A++L+YHLQS Sbjct: 248 SFSSMVVTLKLYIEDVKAGKLNFHYGTINKRPGTSPSDIHAYTLEYHLQS 297