BLASTX nr result
ID: Zanthoxylum22_contig00030452
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00030452 (351 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO64580.1| hypothetical protein CISIN_1g0482802mg, partial [... 113 6e-23 ref|XP_006469213.1| PREDICTED: cysteine-rich receptor-like prote... 113 6e-23 ref|XP_006448211.1| hypothetical protein CICLE_v10015463mg [Citr... 113 6e-23 ref|XP_007045211.1| Cysteine-rich receptor-like protein kinase 1... 101 2e-19 ref|XP_014507399.1| PREDICTED: putative receptor-like protein ki... 98 2e-18 ref|XP_007223006.1| hypothetical protein PRUPE_ppa006805mg [Prun... 97 6e-18 ref|XP_003631201.1| PREDICTED: cysteine-rich receptor-like prote... 96 8e-18 emb|CAN71621.1| hypothetical protein VITISV_016299 [Vitis vinifera] 96 8e-18 gb|KOM25040.1| hypothetical protein LR48_Vigan46s000200 [Vigna a... 96 1e-17 gb|KRH42531.1| hypothetical protein GLYMA_08G094800 [Glycine max] 94 3e-17 ref|XP_008464706.1| PREDICTED: putative receptor-like protein ki... 94 3e-17 ref|XP_008464705.1| PREDICTED: putative receptor-like protein ki... 94 3e-17 ref|XP_008221435.1| PREDICTED: putative cysteine-rich receptor-l... 94 3e-17 ref|XP_003532692.1| PREDICTED: cysteine-rich receptor-like prote... 94 3e-17 ref|XP_010066599.1| PREDICTED: putative receptor-like protein ki... 93 9e-17 ref|XP_012072265.1| PREDICTED: putative receptor-like protein ki... 92 1e-16 ref|XP_012072264.1| PREDICTED: putative receptor-like protein ki... 92 1e-16 gb|KNA13876.1| hypothetical protein SOVF_112660 [Spinacia oleracea] 92 2e-16 ref|XP_012467254.1| PREDICTED: putative receptor-like protein ki... 91 3e-16 ref|XP_012467253.1| PREDICTED: putative receptor-like protein ki... 91 3e-16 >gb|KDO64580.1| hypothetical protein CISIN_1g0482802mg, partial [Citrus sinensis] Length = 228 Score = 113 bits (282), Expect = 6e-23 Identities = 55/65 (84%), Positives = 58/65 (89%) Frame = -2 Query: 350 IVDPSLAGSGSAEQIAMCIQIGLLCTQGDPQLRPTMSRVVVMLSKKPGSGSLEEPTKPRV 171 IVDPSLA S S +QIAMCIQIGLLCTQGDPQLRPTM RVVVMLSKKPG G+LEEPT+P V Sbjct: 104 IVDPSLAASDSGDQIAMCIQIGLLCTQGDPQLRPTMRRVVVMLSKKPGPGNLEEPTRPGV 163 Query: 170 PGSGY 156 PGS Y Sbjct: 164 PGSRY 168 >ref|XP_006469213.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like [Citrus sinensis] Length = 404 Score = 113 bits (282), Expect = 6e-23 Identities = 55/65 (84%), Positives = 58/65 (89%) Frame = -2 Query: 350 IVDPSLAGSGSAEQIAMCIQIGLLCTQGDPQLRPTMSRVVVMLSKKPGSGSLEEPTKPRV 171 IVDPSLA S S +QIAMCIQIGLLCTQGDPQLRPTM RVVVMLSKKPG G+LEEPT+P V Sbjct: 280 IVDPSLAASDSGDQIAMCIQIGLLCTQGDPQLRPTMRRVVVMLSKKPGPGNLEEPTRPGV 339 Query: 170 PGSGY 156 PGS Y Sbjct: 340 PGSRY 344 >ref|XP_006448211.1| hypothetical protein CICLE_v10015463mg [Citrus clementina] gi|557550822|gb|ESR61451.1| hypothetical protein CICLE_v10015463mg [Citrus clementina] Length = 404 Score = 113 bits (282), Expect = 6e-23 Identities = 55/65 (84%), Positives = 58/65 (89%) Frame = -2 Query: 350 IVDPSLAGSGSAEQIAMCIQIGLLCTQGDPQLRPTMSRVVVMLSKKPGSGSLEEPTKPRV 171 IVDPSLA S S +QIAMCIQIGLLCTQGDPQLRPTM RVVVMLSKKPG G+LEEPT+P V Sbjct: 280 IVDPSLAASDSGDQIAMCIQIGLLCTQGDPQLRPTMRRVVVMLSKKPGPGNLEEPTRPGV 339 Query: 170 PGSGY 156 PGS Y Sbjct: 340 PGSRY 344 >ref|XP_007045211.1| Cysteine-rich receptor-like protein kinase 10 [Theobroma cacao] gi|508709146|gb|EOY01043.1| Cysteine-rich receptor-like protein kinase 10 [Theobroma cacao] Length = 404 Score = 101 bits (251), Expect = 2e-19 Identities = 50/65 (76%), Positives = 56/65 (86%) Frame = -2 Query: 350 IVDPSLAGSGSAEQIAMCIQIGLLCTQGDPQLRPTMSRVVVMLSKKPGSGSLEEPTKPRV 171 I+DP+LA S + EQ+AMCIQIGLLCTQ DPQLRPTM RVVVMLSKKP GS+EEPT+P V Sbjct: 282 IMDPALAPSAAPEQVAMCIQIGLLCTQSDPQLRPTMGRVVVMLSKKP--GSIEEPTRPGV 339 Query: 170 PGSGY 156 PGS Y Sbjct: 340 PGSRY 344 >ref|XP_014507399.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Vigna radiata var. radiata] Length = 404 Score = 98.2 bits (243), Expect = 2e-18 Identities = 47/65 (72%), Positives = 56/65 (86%) Frame = -2 Query: 350 IVDPSLAGSGSAEQIAMCIQIGLLCTQGDPQLRPTMSRVVVMLSKKPGSGSLEEPTKPRV 171 IVDP+LAG+ E++AMCIQ+GLLCTQGDPQLRPTM RVVVMLS+KP G ++EPT+P V Sbjct: 288 IVDPTLAGTMVGEEVAMCIQMGLLCTQGDPQLRPTMRRVVVMLSRKP--GQMQEPTRPGV 345 Query: 170 PGSGY 156 PGS Y Sbjct: 346 PGSRY 350 >ref|XP_007223006.1| hypothetical protein PRUPE_ppa006805mg [Prunus persica] gi|462419942|gb|EMJ24205.1| hypothetical protein PRUPE_ppa006805mg [Prunus persica] Length = 394 Score = 96.7 bits (239), Expect = 6e-18 Identities = 48/65 (73%), Positives = 54/65 (83%) Frame = -2 Query: 350 IVDPSLAGSGSAEQIAMCIQIGLLCTQGDPQLRPTMSRVVVMLSKKPGSGSLEEPTKPRV 171 I+DP+LA S EQ+AMCIQIGLLC QGDPQLRPTM RVVV+LSKKP +LEEPT+P V Sbjct: 280 IMDPTLASSAVTEQVAMCIQIGLLCIQGDPQLRPTMHRVVVILSKKP--SNLEEPTRPGV 337 Query: 170 PGSGY 156 PGS Y Sbjct: 338 PGSRY 342 >ref|XP_003631201.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Vitis vinifera] gi|297737665|emb|CBI26866.3| unnamed protein product [Vitis vinifera] Length = 402 Score = 96.3 bits (238), Expect = 8e-18 Identities = 47/65 (72%), Positives = 53/65 (81%) Frame = -2 Query: 350 IVDPSLAGSGSAEQIAMCIQIGLLCTQGDPQLRPTMSRVVVMLSKKPGSGSLEEPTKPRV 171 ++DPSLA S AEQ+AMC+QIGLLCTQ DPQ RP M RVVVMLSKKP G+LEEPT+P Sbjct: 288 VLDPSLASSAVAEQVAMCVQIGLLCTQADPQSRPNMRRVVVMLSKKP--GTLEEPTRPGY 345 Query: 170 PGSGY 156 PGS Y Sbjct: 346 PGSRY 350 >emb|CAN71621.1| hypothetical protein VITISV_016299 [Vitis vinifera] Length = 437 Score = 96.3 bits (238), Expect = 8e-18 Identities = 47/65 (72%), Positives = 53/65 (81%) Frame = -2 Query: 350 IVDPSLAGSGSAEQIAMCIQIGLLCTQGDPQLRPTMSRVVVMLSKKPGSGSLEEPTKPRV 171 ++DPSLA S AEQ+AMC+QIGLLCTQ DPQ RP M RVVVMLSKKP G+LEEPT+P Sbjct: 323 VLDPSLASSAVAEQVAMCVQIGLLCTQADPQSRPNMRRVVVMLSKKP--GTLEEPTRPGY 380 Query: 170 PGSGY 156 PGS Y Sbjct: 381 PGSRY 385 >gb|KOM25040.1| hypothetical protein LR48_Vigan46s000200 [Vigna angularis] Length = 405 Score = 95.5 bits (236), Expect = 1e-17 Identities = 46/65 (70%), Positives = 55/65 (84%) Frame = -2 Query: 350 IVDPSLAGSGSAEQIAMCIQIGLLCTQGDPQLRPTMSRVVVMLSKKPGSGSLEEPTKPRV 171 IVDP+LA + E++AMCIQ+GLLCTQGDPQLRPTM RVVVMLS+KP G ++EPT+P V Sbjct: 286 IVDPTLADTMVGEEVAMCIQMGLLCTQGDPQLRPTMRRVVVMLSRKP--GQMQEPTRPGV 343 Query: 170 PGSGY 156 PGS Y Sbjct: 344 PGSRY 348 >gb|KRH42531.1| hypothetical protein GLYMA_08G094800 [Glycine max] Length = 308 Score = 94.4 bits (233), Expect = 3e-17 Identities = 45/65 (69%), Positives = 56/65 (86%) Frame = -2 Query: 350 IVDPSLAGSGSAEQIAMCIQIGLLCTQGDPQLRPTMSRVVVMLSKKPGSGSLEEPTKPRV 171 IVD +LA + AE++AMC+Q+GLLCTQGDPQLRPTM RVVVMLS+KP G+++EPT+P V Sbjct: 187 IVDSALASTIVAEEVAMCVQLGLLCTQGDPQLRPTMRRVVVMLSRKP--GNMQEPTRPGV 244 Query: 170 PGSGY 156 PGS Y Sbjct: 245 PGSRY 249 >ref|XP_008464706.1| PREDICTED: putative receptor-like protein kinase At4g00960 isoform X2 [Cucumis melo] Length = 411 Score = 94.4 bits (233), Expect = 3e-17 Identities = 44/65 (67%), Positives = 54/65 (83%) Frame = -2 Query: 350 IVDPSLAGSGSAEQIAMCIQIGLLCTQGDPQLRPTMSRVVVMLSKKPGSGSLEEPTKPRV 171 I+DP+LA S +Q+ MCIQIGLLCTQGDP LRPTM RVV++LSK+P G+LEEPT+P + Sbjct: 280 IMDPTLASSADPDQVTMCIQIGLLCTQGDPHLRPTMPRVVLILSKRP--GNLEEPTRPGI 337 Query: 170 PGSGY 156 PGS Y Sbjct: 338 PGSRY 342 >ref|XP_008464705.1| PREDICTED: putative receptor-like protein kinase At4g00960 isoform X1 [Cucumis melo] Length = 412 Score = 94.4 bits (233), Expect = 3e-17 Identities = 44/65 (67%), Positives = 54/65 (83%) Frame = -2 Query: 350 IVDPSLAGSGSAEQIAMCIQIGLLCTQGDPQLRPTMSRVVVMLSKKPGSGSLEEPTKPRV 171 I+DP+LA S +Q+ MCIQIGLLCTQGDP LRPTM RVV++LSK+P G+LEEPT+P + Sbjct: 281 IMDPTLASSADPDQVTMCIQIGLLCTQGDPHLRPTMPRVVLILSKRP--GNLEEPTRPGI 338 Query: 170 PGSGY 156 PGS Y Sbjct: 339 PGSRY 343 >ref|XP_008221435.1| PREDICTED: putative cysteine-rich receptor-like protein kinase 35 [Prunus mume] Length = 394 Score = 94.4 bits (233), Expect = 3e-17 Identities = 47/65 (72%), Positives = 54/65 (83%) Frame = -2 Query: 350 IVDPSLAGSGSAEQIAMCIQIGLLCTQGDPQLRPTMSRVVVMLSKKPGSGSLEEPTKPRV 171 I+DP+LA S EQ+AMCIQ+GLLC QGDPQLRPTM RVVV+LSKKP +LEEPT+P V Sbjct: 280 IMDPTLASSVVTEQVAMCIQMGLLCIQGDPQLRPTMHRVVVILSKKP--SNLEEPTRPGV 337 Query: 170 PGSGY 156 PGS Y Sbjct: 338 PGSRY 342 >ref|XP_003532692.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like [Glycine max] gi|734350524|gb|KHN12471.1| Cysteine-rich receptor-like protein kinase 10 [Glycine soja] gi|947093945|gb|KRH42530.1| hypothetical protein GLYMA_08G094800 [Glycine max] Length = 405 Score = 94.4 bits (233), Expect = 3e-17 Identities = 45/65 (69%), Positives = 56/65 (86%) Frame = -2 Query: 350 IVDPSLAGSGSAEQIAMCIQIGLLCTQGDPQLRPTMSRVVVMLSKKPGSGSLEEPTKPRV 171 IVD +LA + AE++AMC+Q+GLLCTQGDPQLRPTM RVVVMLS+KP G+++EPT+P V Sbjct: 284 IVDSALASTIVAEEVAMCVQLGLLCTQGDPQLRPTMRRVVVMLSRKP--GNMQEPTRPGV 341 Query: 170 PGSGY 156 PGS Y Sbjct: 342 PGSRY 346 >ref|XP_010066599.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Eucalyptus grandis] gi|629098788|gb|KCW64553.1| hypothetical protein EUGRSUZ_G02158 [Eucalyptus grandis] Length = 407 Score = 92.8 bits (229), Expect = 9e-17 Identities = 47/66 (71%), Positives = 56/66 (84%), Gaps = 1/66 (1%) Frame = -2 Query: 350 IVDPSLAGSGSAEQIAMCIQIGLLCTQGDPQLRPTMSRVVVMLSKKPGSGSLEEP-TKPR 174 IVD +LA S SA+Q+AMCIQIGLLCTQGDP LRPTM RVVV+LSKKP G+L+EP T+P Sbjct: 281 IVDTALASSASADQVAMCIQIGLLCTQGDPHLRPTMGRVVVLLSKKP--GNLDEPITRPG 338 Query: 173 VPGSGY 156 +PG+ Y Sbjct: 339 LPGTRY 344 >ref|XP_012072265.1| PREDICTED: putative receptor-like protein kinase At4g00960 isoform X2 [Jatropha curcas] Length = 396 Score = 92.4 bits (228), Expect = 1e-16 Identities = 45/65 (69%), Positives = 52/65 (80%) Frame = -2 Query: 350 IVDPSLAGSGSAEQIAMCIQIGLLCTQGDPQLRPTMSRVVVMLSKKPGSGSLEEPTKPRV 171 I+DP+LA S AEQ+ +CI IGLLCTQ DP LRP M RVV++LSKKP GSLEEPT+P V Sbjct: 279 IMDPTLASSAVAEQVKLCIHIGLLCTQSDPNLRPDMRRVVILLSKKP--GSLEEPTRPGV 336 Query: 170 PGSGY 156 PGS Y Sbjct: 337 PGSRY 341 >ref|XP_012072264.1| PREDICTED: putative receptor-like protein kinase At4g00960 isoform X1 [Jatropha curcas] gi|643730654|gb|KDP38086.1| hypothetical protein JCGZ_04729 [Jatropha curcas] Length = 397 Score = 92.4 bits (228), Expect = 1e-16 Identities = 45/65 (69%), Positives = 52/65 (80%) Frame = -2 Query: 350 IVDPSLAGSGSAEQIAMCIQIGLLCTQGDPQLRPTMSRVVVMLSKKPGSGSLEEPTKPRV 171 I+DP+LA S AEQ+ +CI IGLLCTQ DP LRP M RVV++LSKKP GSLEEPT+P V Sbjct: 280 IMDPTLASSAVAEQVKLCIHIGLLCTQSDPNLRPDMRRVVILLSKKP--GSLEEPTRPGV 337 Query: 170 PGSGY 156 PGS Y Sbjct: 338 PGSRY 342 >gb|KNA13876.1| hypothetical protein SOVF_112660 [Spinacia oleracea] Length = 190 Score = 91.7 bits (226), Expect = 2e-16 Identities = 43/65 (66%), Positives = 53/65 (81%) Frame = -2 Query: 350 IVDPSLAGSGSAEQIAMCIQIGLLCTQGDPQLRPTMSRVVVMLSKKPGSGSLEEPTKPRV 171 ++DPS+A + AEQ+A+C+QIGLLCTQ DP LRP+M RVVV+LSKKP SLEEPT+P Sbjct: 71 VLDPSIASTADAEQVALCVQIGLLCTQSDPNLRPSMRRVVVLLSKKP--TSLEEPTRPGF 128 Query: 170 PGSGY 156 PGS Y Sbjct: 129 PGSRY 133 >ref|XP_012467254.1| PREDICTED: putative receptor-like protein kinase At4g00960 isoform X2 [Gossypium raimondii] Length = 388 Score = 91.3 bits (225), Expect = 3e-16 Identities = 44/62 (70%), Positives = 51/62 (82%) Frame = -2 Query: 347 VDPSLAGSGSAEQIAMCIQIGLLCTQGDPQLRPTMSRVVVMLSKKPGSGSLEEPTKPRVP 168 +DP LA S EQ+AMCIQIGLLCTQGDPQLRP M RVV++LSK+P GSLEEPT+P P Sbjct: 269 MDPVLASSAVPEQVAMCIQIGLLCTQGDPQLRPDMRRVVILLSKRP--GSLEEPTRPGAP 326 Query: 167 GS 162 G+ Sbjct: 327 GA 328 >ref|XP_012467253.1| PREDICTED: putative receptor-like protein kinase At4g00960 isoform X1 [Gossypium raimondii] gi|763747960|gb|KJB15399.1| hypothetical protein B456_002G176300 [Gossypium raimondii] gi|763747961|gb|KJB15400.1| hypothetical protein B456_002G176300 [Gossypium raimondii] Length = 400 Score = 91.3 bits (225), Expect = 3e-16 Identities = 44/62 (70%), Positives = 51/62 (82%) Frame = -2 Query: 347 VDPSLAGSGSAEQIAMCIQIGLLCTQGDPQLRPTMSRVVVMLSKKPGSGSLEEPTKPRVP 168 +DP LA S EQ+AMCIQIGLLCTQGDPQLRP M RVV++LSK+P GSLEEPT+P P Sbjct: 281 MDPVLASSAVPEQVAMCIQIGLLCTQGDPQLRPDMRRVVILLSKRP--GSLEEPTRPGAP 338 Query: 167 GS 162 G+ Sbjct: 339 GA 340