BLASTX nr result
ID: Zanthoxylum22_contig00030419
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00030419 (364 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AHC13200.1| polyprotein [Citrus endogenous pararetrovirus] 67 4e-09 gb|AHC13197.1| polyprotein [Citrus endogenous pararetrovirus] 67 4e-09 ref|YP_008992013.1| polyprotein [Citrus endogenous pararetroviru... 67 4e-09 ref|XP_010109929.1| hypothetical protein L484_011771 [Morus nota... 60 5e-07 >gb|AHC13200.1| polyprotein [Citrus endogenous pararetrovirus] Length = 1701 Score = 67.4 bits (163), Expect = 4e-09 Identities = 32/48 (66%), Positives = 38/48 (79%) Frame = -3 Query: 167 EMAA*IDLQMTMPGVTLKDVLKEFSTRFTRSLRDWFQALGAYRQLQFV 24 EM+A IDLQM G T + VL+EF+TRFT +LRDWF +LG YRQLQFV Sbjct: 717 EMSAWIDLQMLRSGATTESVLREFATRFTGALRDWFDSLGPYRQLQFV 764 >gb|AHC13197.1| polyprotein [Citrus endogenous pararetrovirus] Length = 1799 Score = 67.4 bits (163), Expect = 4e-09 Identities = 32/48 (66%), Positives = 38/48 (79%) Frame = -3 Query: 167 EMAA*IDLQMTMPGVTLKDVLKEFSTRFTRSLRDWFQALGAYRQLQFV 24 EM+A IDLQM G T + VL+EF+TRFT +LRDWF +LG YRQLQFV Sbjct: 815 EMSAWIDLQMLRSGATTESVLREFATRFTGALRDWFDSLGPYRQLQFV 862 >ref|YP_008992013.1| polyprotein [Citrus endogenous pararetrovirus] gi|565672276|gb|AHC13194.1| polyprotein [Citrus endogenous pararetrovirus] Length = 1812 Score = 67.4 bits (163), Expect = 4e-09 Identities = 32/48 (66%), Positives = 38/48 (79%) Frame = -3 Query: 167 EMAA*IDLQMTMPGVTLKDVLKEFSTRFTRSLRDWFQALGAYRQLQFV 24 EM+A IDLQM G T + VL+EF+TRFT +LRDWF +LG YRQLQFV Sbjct: 828 EMSAWIDLQMLRSGATTESVLREFATRFTGALRDWFDSLGPYRQLQFV 875 >ref|XP_010109929.1| hypothetical protein L484_011771 [Morus notabilis] gi|587938138|gb|EXC24905.1| hypothetical protein L484_011771 [Morus notabilis] Length = 367 Score = 60.5 bits (145), Expect = 5e-07 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = -3 Query: 140 MTMPGVTLKDVLKEFSTRFTRSLRDWFQALGAYRQLQFV 24 MT PG L+ VLKEF++RFT LRDWFQ+LG YRQLQF+ Sbjct: 298 MTKPGAELQAVLKEFASRFTGILRDWFQSLGGYRQLQFI 336