BLASTX nr result
ID: Zanthoxylum22_contig00030402
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00030402 (350 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010102691.1| Protein lap1 [Morus notabilis] gi|587905786|... 56 9e-06 >ref|XP_010102691.1| Protein lap1 [Morus notabilis] gi|587905786|gb|EXB93909.1| Protein lap1 [Morus notabilis] Length = 518 Score = 56.2 bits (134), Expect = 9e-06 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -1 Query: 350 RVDLSSSQLRFLPEAFGRITGLRFMNLSTNQLEV 249 RVDLS QLRFLPEAFGRI GLR +N+S+NQLEV Sbjct: 221 RVDLSGRQLRFLPEAFGRIRGLRVLNVSSNQLEV 254