BLASTX nr result
ID: Zanthoxylum22_contig00030383
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00030383 (323 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006446209.1| hypothetical protein CICLE_v10017291mg [Citr... 78 2e-12 >ref|XP_006446209.1| hypothetical protein CICLE_v10017291mg [Citrus clementina] gi|557548820|gb|ESR59449.1| hypothetical protein CICLE_v10017291mg [Citrus clementina] Length = 98 Score = 78.2 bits (191), Expect = 2e-12 Identities = 41/68 (60%), Positives = 51/68 (75%), Gaps = 1/68 (1%) Frame = -3 Query: 201 CLKLNPVLSSEVRKLKPTCCNCLVMSPQSVKE-RTVSLQIIVMEINDFDLKESLGGLVNG 25 CL LNPV S++V K PTCCNCLV+SP+SVKE + L IVM+ N+FDLK++ G LVN Sbjct: 17 CLTLNPVPSNKVGKHIPTCCNCLVLSPRSVKEMNEILLLDIVMDKNNFDLKDNSGALVNE 76 Query: 24 GEIHVIGM 1 I+VIGM Sbjct: 77 DAIYVIGM 84