BLASTX nr result
ID: Zanthoxylum22_contig00030366
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00030366 (341 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006437178.1| hypothetical protein CICLE_v10032559mg [Citr... 71 4e-10 ref|XP_006484852.1| PREDICTED: glucan endo-1,3-beta-glucosidase ... 69 1e-09 >ref|XP_006437178.1| hypothetical protein CICLE_v10032559mg [Citrus clementina] gi|557539374|gb|ESR50418.1| hypothetical protein CICLE_v10032559mg [Citrus clementina] Length = 246 Score = 70.9 bits (172), Expect = 4e-10 Identities = 36/49 (73%), Positives = 41/49 (83%), Gaps = 2/49 (4%) Frame = -1 Query: 236 MGRGAGFIQIIVLLFCL--CSGSSVTSTQVGMEDKNVQLNSYVSITKRD 96 MGR A FIQI +LLFCL CSG+SVTS Q+G+EDKNVQLNS +S TKRD Sbjct: 1 MGRAASFIQISLLLFCLFLCSGASVTSAQLGIEDKNVQLNSSISTTKRD 49 >ref|XP_006484852.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Citrus sinensis] Length = 246 Score = 68.9 bits (167), Expect = 1e-09 Identities = 35/49 (71%), Positives = 40/49 (81%), Gaps = 2/49 (4%) Frame = -1 Query: 236 MGRGAGFIQIIVLLFCL--CSGSSVTSTQVGMEDKNVQLNSYVSITKRD 96 MGR A FIQI +LLFCL CSG+SVTS Q+G+EDKNV LNS +S TKRD Sbjct: 1 MGRAASFIQISLLLFCLFLCSGASVTSAQLGIEDKNVHLNSSISTTKRD 49