BLASTX nr result
ID: Zanthoxylum22_contig00030365
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00030365 (362 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGC78951.1| hypothetical protein (mitochondrion) [Vicia faba] 84 3e-17 >gb|AGC78951.1| hypothetical protein (mitochondrion) [Vicia faba] Length = 151 Score = 84.0 bits (206), Expect(2) = 3e-17 Identities = 42/43 (97%), Positives = 42/43 (97%) Frame = +2 Query: 86 GPIDSIFMLGTELLFRVKGRAVARTAFTGKFPSTGRGVESTIS 214 GPIDSIFMLGTELLFRVKGRAVARTAFTGKF STGRGVESTIS Sbjct: 109 GPIDSIFMLGTELLFRVKGRAVARTAFTGKFTSTGRGVESTIS 151 Score = 31.2 bits (69), Expect(2) = 3e-17 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = +1 Query: 40 KGKVETFRKRVMAFLG 87 + KVETFRKRVMAF+G Sbjct: 90 RNKVETFRKRVMAFIG 105