BLASTX nr result
ID: Zanthoxylum22_contig00030363
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00030363 (334 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHG27980.1| RNA-binding 24 [Gossypium arboreum] 60 8e-07 >gb|KHG27980.1| RNA-binding 24 [Gossypium arboreum] Length = 372 Score = 59.7 bits (143), Expect = 8e-07 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = -3 Query: 293 AGLRAVGLLLEWRASDLALQIYFLAF*RSYIVILTREV 180 AGLRA LLLEWRASDLALQ+ + AF RSY+V+LTREV Sbjct: 296 AGLRAAELLLEWRASDLALQVIYFAFYRSYVVMLTREV 333