BLASTX nr result
ID: Zanthoxylum22_contig00030148
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00030148 (265 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006478000.1| PREDICTED: pentatricopeptide repeat-containi... 116 6e-24 ref|XP_011008804.1| PREDICTED: pentatricopeptide repeat-containi... 65 3e-08 ref|XP_002322098.1| hypothetical protein POPTR_0015s04490g [Popu... 64 6e-08 ref|XP_009356045.1| PREDICTED: pentatricopeptide repeat-containi... 63 1e-07 ref|XP_008356662.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 61 4e-07 ref|XP_012088542.1| PREDICTED: pentatricopeptide repeat-containi... 60 6e-07 emb|CBI35789.3| unnamed protein product [Vitis vinifera] 60 8e-07 ref|XP_002271048.1| PREDICTED: pentatricopeptide repeat-containi... 60 8e-07 ref|XP_002529554.1| pentatricopeptide repeat-containing protein,... 59 1e-06 ref|XP_009785057.1| PREDICTED: pentatricopeptide repeat-containi... 57 7e-06 ref|XP_010036950.1| PREDICTED: pentatricopeptide repeat-containi... 57 7e-06 ref|XP_004301253.1| PREDICTED: pentatricopeptide repeat-containi... 57 7e-06 ref|XP_007208935.1| hypothetical protein PRUPE_ppb014337mg, part... 57 7e-06 ref|XP_010097570.1| hypothetical protein L484_017380 [Morus nota... 56 9e-06 ref|XP_008240292.1| PREDICTED: pentatricopeptide repeat-containi... 56 9e-06 >ref|XP_006478000.1| PREDICTED: pentatricopeptide repeat-containing protein At3g18020-like isoform X1 [Citrus sinensis] gi|568848405|ref|XP_006478001.1| PREDICTED: pentatricopeptide repeat-containing protein At3g18020-like isoform X2 [Citrus sinensis] gi|568848407|ref|XP_006478002.1| PREDICTED: pentatricopeptide repeat-containing protein At3g18020-like isoform X3 [Citrus sinensis] gi|568848409|ref|XP_006478003.1| PREDICTED: pentatricopeptide repeat-containing protein At3g18020-like isoform X4 [Citrus sinensis] Length = 676 Score = 116 bits (291), Expect = 6e-24 Identities = 64/82 (78%), Positives = 68/82 (82%), Gaps = 4/82 (4%) Frame = -2 Query: 234 LLTYHSKLISLTKPNFTFALFF-TTLPSK-QEPLN--TLESEQNITKTIHKLCTKDRNVD 67 L + KL SLTKPN TFALFF TTLP QEPLN T ESEQ+ITK IH+LCTKDRNVD Sbjct: 9 LFHHPKKLNSLTKPNITFALFFFTTLPQNVQEPLNINTHESEQDITKKIHRLCTKDRNVD 68 Query: 66 EALRYLDHLRIFGYRPNSLNIS 1 EALR+LDHLRIFGYRPNSLNIS Sbjct: 69 EALRFLDHLRIFGYRPNSLNIS 90 >ref|XP_011008804.1| PREDICTED: pentatricopeptide repeat-containing protein At3g18020 [Populus euphratica] Length = 671 Score = 64.7 bits (156), Expect = 3e-08 Identities = 42/90 (46%), Positives = 52/90 (57%), Gaps = 13/90 (14%) Frame = -2 Query: 231 LTYHSKLISLT---KPNFTFALFFTTLPSKQ--EPLNTLESEQNI--------TKTIHKL 91 LT SKL L+ KP + F +T P Q + L + +Q+I TK IH L Sbjct: 3 LTNLSKLKKLSVPFKPKLSPLSFLSTHPESQPHQELALIHQQQSICITNRSYWTKKIHDL 62 Query: 90 CTKDRNVDEALRYLDHLRIFGYRPNSLNIS 1 CTK NVDEALR LDHLR+ GY P+SLN+S Sbjct: 63 CTKHHNVDEALRLLDHLRLRGYLPDSLNLS 92 >ref|XP_002322098.1| hypothetical protein POPTR_0015s04490g [Populus trichocarpa] gi|222869094|gb|EEF06225.1| hypothetical protein POPTR_0015s04490g [Populus trichocarpa] Length = 668 Score = 63.5 bits (153), Expect = 6e-08 Identities = 46/95 (48%), Positives = 55/95 (57%), Gaps = 12/95 (12%) Frame = -2 Query: 249 MLLATLLTYHSKLISLT---KPNFTFALFFTTLPSKQEP-LNTLESEQNI--------TK 106 M LA L SKL L+ KP + F +T P QE LN +Q+I T+ Sbjct: 1 MFLANL----SKLKKLSIPFKPKLSPLSFLSTHPQNQEQALN--HQQQSICITNRSYWTQ 54 Query: 105 TIHKLCTKDRNVDEALRYLDHLRIFGYRPNSLNIS 1 IH LCTK RNVDEALR LDHLR+ GY P+SLN+S Sbjct: 55 KIHDLCTKHRNVDEALRLLDHLRLRGYLPDSLNLS 89 >ref|XP_009356045.1| PREDICTED: pentatricopeptide repeat-containing protein At3g18020 [Pyrus x bretschneideri] Length = 698 Score = 62.8 bits (151), Expect = 1e-07 Identities = 39/90 (43%), Positives = 49/90 (54%), Gaps = 12/90 (13%) Frame = -2 Query: 234 LLTYHSKLISLTKPNFTFALFF---TTLPSKQEPLNTLESEQNI---------TKTIHKL 91 L ++ S +T T L F T+ PS Q+P L +Q I TK IH L Sbjct: 12 LTSFPSSKTLITPKTLTLPLAFLSTTSPPSDQQPPQHLHQDQAISIEDNRSYFTKKIHSL 71 Query: 90 CTKDRNVDEALRYLDHLRIFGYRPNSLNIS 1 C R+VDEALR LD LR+ GYRP+SLN+S Sbjct: 72 CATHRDVDEALRLLDRLRLQGYRPDSLNLS 101 >ref|XP_008356662.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At3g18020-like [Malus domestica] gi|658057734|ref|XP_008364651.1| PREDICTED: pentatricopeptide repeat-containing protein At3g18020-like [Malus domestica] Length = 690 Score = 60.8 bits (146), Expect = 4e-07 Identities = 37/80 (46%), Positives = 45/80 (56%), Gaps = 12/80 (15%) Frame = -2 Query: 204 LTKPNFTFALFF---TTLPSKQEPLNTLESEQNI---------TKTIHKLCTKDRNVDEA 61 +T T L F T+ PS Q+P L +Q I TK IH LC R+VDEA Sbjct: 13 ITPKTLTLPLAFLSTTSPPSDQQPPQHLHQDQAISIEDNRSYFTKKIHTLCATHRDVDEA 72 Query: 60 LRYLDHLRIFGYRPNSLNIS 1 LR LD LR+ GYRP+SLN+S Sbjct: 73 LRLLDRLRLQGYRPDSLNLS 92 >ref|XP_012088542.1| PREDICTED: pentatricopeptide repeat-containing protein At3g18020 [Jatropha curcas] gi|643709310|gb|KDP23918.1| hypothetical protein JCGZ_27078 [Jatropha curcas] Length = 666 Score = 60.1 bits (144), Expect = 6e-07 Identities = 38/87 (43%), Positives = 51/87 (58%), Gaps = 9/87 (10%) Frame = -2 Query: 234 LLTYHSKLISLTKPNFTFALFFTT--LPSKQEPLN-------TLESEQNITKTIHKLCTK 82 +L H + L P F FF+T LP+ EPL+ ++ + T+ IH LCT+ Sbjct: 1 MLLIHFRNQILLNPIFIRLSFFSTYQLPNT-EPLHQDHEEAISIANRSYWTRKIHDLCTQ 59 Query: 81 DRNVDEALRYLDHLRIFGYRPNSLNIS 1 R VDEAL LDHLR+ GYRP+SLN+S Sbjct: 60 HRKVDEALALLDHLRLRGYRPDSLNLS 86 >emb|CBI35789.3| unnamed protein product [Vitis vinifera] Length = 912 Score = 59.7 bits (143), Expect = 8e-07 Identities = 31/66 (46%), Positives = 43/66 (65%), Gaps = 6/66 (9%) Frame = -2 Query: 180 ALFFTTLPSKQEPLNTLESEQNI------TKTIHKLCTKDRNVDEALRYLDHLRIFGYRP 19 A FF+ + + + E++I ++ IH LCT+DRNVDEALR LD LR+ GYRP Sbjct: 267 AFFFSAQSTPNQQHEEEKEEESIINKAFWSRKIHNLCTRDRNVDEALRLLDLLRLRGYRP 326 Query: 18 NSLNIS 1 +SLN+S Sbjct: 327 DSLNLS 332 >ref|XP_002271048.1| PREDICTED: pentatricopeptide repeat-containing protein At3g18020 [Vitis vinifera] Length = 680 Score = 59.7 bits (143), Expect = 8e-07 Identities = 31/66 (46%), Positives = 43/66 (65%), Gaps = 6/66 (9%) Frame = -2 Query: 180 ALFFTTLPSKQEPLNTLESEQNI------TKTIHKLCTKDRNVDEALRYLDHLRIFGYRP 19 A FF+ + + + E++I ++ IH LCT+DRNVDEALR LD LR+ GYRP Sbjct: 35 AFFFSAQSTPNQQHEEEKEEESIINKAFWSRKIHNLCTRDRNVDEALRLLDLLRLRGYRP 94 Query: 18 NSLNIS 1 +SLN+S Sbjct: 95 DSLNLS 100 >ref|XP_002529554.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223530966|gb|EEF32823.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 678 Score = 58.9 bits (141), Expect = 1e-06 Identities = 29/57 (50%), Positives = 37/57 (64%) Frame = -2 Query: 171 FTTLPSKQEPLNTLESEQNITKTIHKLCTKDRNVDEALRYLDHLRIFGYRPNSLNIS 1 + L +QE ++ + TK IH LCT+ R VDEAL LDHLR+ GYRP+SLN S Sbjct: 41 YQQLQQEQEQPISITNSSYWTKKIHLLCTQQRKVDEALTLLDHLRLSGYRPDSLNFS 97 >ref|XP_009785057.1| PREDICTED: pentatricopeptide repeat-containing protein At3g18020 [Nicotiana sylvestris] Length = 696 Score = 56.6 bits (135), Expect = 7e-06 Identities = 26/46 (56%), Positives = 33/46 (71%) Frame = -2 Query: 138 NTLESEQNITKTIHKLCTKDRNVDEALRYLDHLRIFGYRPNSLNIS 1 N ++ + T+ IHKLC D NVDEALR LD LR+ GY P+SLN+S Sbjct: 57 NLIDDKTYWTRRIHKLCAIDGNVDEALRLLDELRLHGYHPDSLNLS 102 >ref|XP_010036950.1| PREDICTED: pentatricopeptide repeat-containing protein At3g18020 [Eucalyptus grandis] gi|629082158|gb|KCW48603.1| hypothetical protein EUGRSUZ_K02270 [Eucalyptus grandis] Length = 711 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/37 (67%), Positives = 30/37 (81%) Frame = -2 Query: 111 TKTIHKLCTKDRNVDEALRYLDHLRIFGYRPNSLNIS 1 T+ IH LCT+ RNVD ALR LDHLR+ GYRP+ LN+S Sbjct: 66 TRKIHDLCTRHRNVDAALRLLDHLRLRGYRPDPLNLS 102 >ref|XP_004301253.1| PREDICTED: pentatricopeptide repeat-containing protein At3g18020 [Fragaria vesca subsp. vesca] Length = 682 Score = 56.6 bits (135), Expect = 7e-06 Identities = 30/69 (43%), Positives = 44/69 (63%) Frame = -2 Query: 207 SLTKPNFTFALFFTTLPSKQEPLNTLESEQNITKTIHKLCTKDRNVDEALRYLDHLRIFG 28 +LT P F ++T S + ++ +++ TKTIH LCT+ RNVD+AL LDHL + G Sbjct: 17 TLTIPLTFFFTHYSTSASHLDQIS-VDNTPYWTKTIHHLCTRHRNVDQALHLLDHLHLRG 75 Query: 27 YRPNSLNIS 1 YRP LN++ Sbjct: 76 YRPVPLNLT 84 >ref|XP_007208935.1| hypothetical protein PRUPE_ppb014337mg, partial [Prunus persica] gi|462404670|gb|EMJ10134.1| hypothetical protein PRUPE_ppb014337mg, partial [Prunus persica] Length = 681 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/45 (55%), Positives = 33/45 (73%) Frame = -2 Query: 135 TLESEQNITKTIHKLCTKDRNVDEALRYLDHLRIFGYRPNSLNIS 1 ++++ TK IH LCT RNVD+AL LD LR+ GYRP+SLN+S Sbjct: 42 SIDNRSYWTKKIHSLCTAHRNVDQALHLLDRLRLLGYRPDSLNLS 86 >ref|XP_010097570.1| hypothetical protein L484_017380 [Morus notabilis] gi|587880145|gb|EXB69102.1| hypothetical protein L484_017380 [Morus notabilis] Length = 714 Score = 56.2 bits (134), Expect = 9e-06 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = -2 Query: 111 TKTIHKLCTKDRNVDEALRYLDHLRIFGYRPNSLNIS 1 TKTIH LCT+ RNVDEAL LD L + GYRP+SLN+S Sbjct: 70 TKTIHNLCTRHRNVDEALCLLDRLSLRGYRPDSLNLS 106 >ref|XP_008240292.1| PREDICTED: pentatricopeptide repeat-containing protein At3g18020 [Prunus mume] Length = 691 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/45 (55%), Positives = 33/45 (73%) Frame = -2 Query: 135 TLESEQNITKTIHKLCTKDRNVDEALRYLDHLRIFGYRPNSLNIS 1 ++++ TK IH LCT RNVD+AL LD LR+ GYRP+SLN+S Sbjct: 52 SIDNRSYWTKKIHTLCTAHRNVDQALHLLDRLRLLGYRPDSLNLS 96