BLASTX nr result
ID: Zanthoxylum22_contig00030109
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00030109 (278 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006492334.1| PREDICTED: ocs element-binding factor 1-like... 60 6e-07 ref|XP_006444493.1| hypothetical protein CICLE_v10022730mg [Citr... 60 6e-07 >ref|XP_006492334.1| PREDICTED: ocs element-binding factor 1-like [Citrus sinensis] Length = 145 Score = 60.1 bits (144), Expect = 6e-07 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -2 Query: 97 MGSIQRQGSSGSDGDPRYADVDEKKRKRMISN 2 M SIQRQGSSGSD DPRYA+VDE+KRKRMISN Sbjct: 1 MASIQRQGSSGSDSDPRYANVDERKRKRMISN 32 >ref|XP_006444493.1| hypothetical protein CICLE_v10022730mg [Citrus clementina] gi|557546755|gb|ESR57733.1| hypothetical protein CICLE_v10022730mg [Citrus clementina] gi|641868315|gb|KDO86999.1| hypothetical protein CISIN_1g032187mg [Citrus sinensis] Length = 145 Score = 60.1 bits (144), Expect = 6e-07 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -2 Query: 97 MGSIQRQGSSGSDGDPRYADVDEKKRKRMISN 2 M SIQRQGSSGSD DPRYA+VDE+KRKRMISN Sbjct: 1 MASIQRQGSSGSDSDPRYANVDERKRKRMISN 32