BLASTX nr result
ID: Zanthoxylum22_contig00030077
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00030077 (284 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO62429.1| hypothetical protein CISIN_1g008650mg [Citrus sin... 98 2e-18 ref|XP_006474137.1| PREDICTED: probable receptor-like serine/thr... 98 2e-18 ref|XP_006474136.1| PREDICTED: probable receptor-like serine/thr... 98 2e-18 ref|XP_006453444.1| hypothetical protein CICLE_v10007784mg [Citr... 98 2e-18 ref|XP_007014101.1| LRR receptor-like serine/threonine-protein k... 96 1e-17 gb|KHG15349.1| hypothetical protein F383_17411 [Gossypium arboreum] 96 1e-17 ref|XP_011012684.1| PREDICTED: probable receptor-like serine/thr... 94 5e-17 ref|XP_011012683.1| PREDICTED: probable receptor-like serine/thr... 94 5e-17 ref|XP_006381845.1| hypothetical protein POPTR_0006s18770g [Popu... 94 5e-17 gb|KJB76587.1| hypothetical protein B456_012G095500 [Gossypium r... 93 9e-17 ref|XP_012460813.1| PREDICTED: probable receptor-like serine/thr... 93 9e-17 ref|XP_002534342.1| conserved hypothetical protein [Ricinus comm... 87 5e-15 ref|XP_012065277.1| PREDICTED: probable receptor-like serine/thr... 87 6e-15 gb|KOM29038.1| hypothetical protein LR48_Vigan627s008700 [Vigna ... 86 8e-15 ref|XP_006600504.1| PREDICTED: probable receptor-like serine/thr... 86 8e-15 ref|XP_007154802.1| hypothetical protein PHAVU_003G149100g [Phas... 86 8e-15 ref|XP_007154801.1| hypothetical protein PHAVU_003G149100g [Phas... 86 8e-15 ref|XP_003550670.1| PREDICTED: probable receptor-like serine/thr... 86 8e-15 ref|XP_014508011.1| PREDICTED: probable receptor-like serine/thr... 86 1e-14 gb|KHN17563.1| Putative receptor-like serine/threonine-protein k... 86 1e-14 >gb|KDO62429.1| hypothetical protein CISIN_1g008650mg [Citrus sinensis] Length = 558 Score = 98.2 bits (243), Expect = 2e-18 Identities = 47/54 (87%), Positives = 49/54 (90%) Frame = -3 Query: 282 RPSMSEVLELLTSGHDSEFAKNWGMPKLISDELDDYSMVFGYEVPTDIDLEEFL 121 RPSMSEVLELLTSGHDSEFAK+W MP+ SDELDD SM FGYEVPTDIDLEEFL Sbjct: 505 RPSMSEVLELLTSGHDSEFAKSWRMPEFTSDELDDCSMFFGYEVPTDIDLEEFL 558 >ref|XP_006474137.1| PREDICTED: probable receptor-like serine/threonine-protein kinase At5g57670-like isoform X2 [Citrus sinensis] Length = 604 Score = 98.2 bits (243), Expect = 2e-18 Identities = 47/54 (87%), Positives = 49/54 (90%) Frame = -3 Query: 282 RPSMSEVLELLTSGHDSEFAKNWGMPKLISDELDDYSMVFGYEVPTDIDLEEFL 121 RPSMSEVLELLTSGHDSEFAK+W MP+ SDELDD SM FGYEVPTDIDLEEFL Sbjct: 551 RPSMSEVLELLTSGHDSEFAKSWRMPEFTSDELDDCSMFFGYEVPTDIDLEEFL 604 >ref|XP_006474136.1| PREDICTED: probable receptor-like serine/threonine-protein kinase At5g57670-like isoform X1 [Citrus sinensis] Length = 605 Score = 98.2 bits (243), Expect = 2e-18 Identities = 47/54 (87%), Positives = 49/54 (90%) Frame = -3 Query: 282 RPSMSEVLELLTSGHDSEFAKNWGMPKLISDELDDYSMVFGYEVPTDIDLEEFL 121 RPSMSEVLELLTSGHDSEFAK+W MP+ SDELDD SM FGYEVPTDIDLEEFL Sbjct: 552 RPSMSEVLELLTSGHDSEFAKSWRMPEFTSDELDDCSMFFGYEVPTDIDLEEFL 605 >ref|XP_006453444.1| hypothetical protein CICLE_v10007784mg [Citrus clementina] gi|557556670|gb|ESR66684.1| hypothetical protein CICLE_v10007784mg [Citrus clementina] Length = 607 Score = 98.2 bits (243), Expect = 2e-18 Identities = 47/54 (87%), Positives = 49/54 (90%) Frame = -3 Query: 282 RPSMSEVLELLTSGHDSEFAKNWGMPKLISDELDDYSMVFGYEVPTDIDLEEFL 121 RPSMSEVLELLTSGHDSEFAK+W MP+ SDELDD SM FGYEVPTDIDLEEFL Sbjct: 554 RPSMSEVLELLTSGHDSEFAKSWRMPEFTSDELDDCSMFFGYEVPTDIDLEEFL 607 >ref|XP_007014101.1| LRR receptor-like serine/threonine-protein kinase [Theobroma cacao] gi|508784464|gb|EOY31720.1| LRR receptor-like serine/threonine-protein kinase [Theobroma cacao] Length = 623 Score = 95.9 bits (237), Expect = 1e-17 Identities = 45/54 (83%), Positives = 48/54 (88%) Frame = -3 Query: 282 RPSMSEVLELLTSGHDSEFAKNWGMPKLISDELDDYSMVFGYEVPTDIDLEEFL 121 RPSMSEVLELL +GHDS+ AK+W MPK SDELDDYSMVFGYEVPTDI LEEFL Sbjct: 570 RPSMSEVLELLVTGHDSDVAKSWRMPKFTSDELDDYSMVFGYEVPTDISLEEFL 623 >gb|KHG15349.1| hypothetical protein F383_17411 [Gossypium arboreum] Length = 605 Score = 95.5 bits (236), Expect = 1e-17 Identities = 45/54 (83%), Positives = 48/54 (88%) Frame = -3 Query: 282 RPSMSEVLELLTSGHDSEFAKNWGMPKLISDELDDYSMVFGYEVPTDIDLEEFL 121 RPSMSEVLELL +GHDS+ AK+W MPK SDELDDYSMVFGYEVPTDI LEEFL Sbjct: 551 RPSMSEVLELLMTGHDSDVAKSWRMPKFTSDELDDYSMVFGYEVPTDISLEEFL 604 >ref|XP_011012684.1| PREDICTED: probable receptor-like serine/threonine-protein kinase At5g57670 isoform X2 [Populus euphratica] Length = 603 Score = 93.6 bits (231), Expect = 5e-17 Identities = 43/54 (79%), Positives = 48/54 (88%) Frame = -3 Query: 282 RPSMSEVLELLTSGHDSEFAKNWGMPKLISDELDDYSMVFGYEVPTDIDLEEFL 121 RPSMSEVLELLTSGHDSE A++W MPK SDELDDYSM+FGYEVP DI LE++L Sbjct: 550 RPSMSEVLELLTSGHDSEVARSWRMPKFTSDELDDYSMIFGYEVPVDIALEDYL 603 >ref|XP_011012683.1| PREDICTED: probable receptor-like serine/threonine-protein kinase At5g57670 isoform X1 [Populus euphratica] Length = 604 Score = 93.6 bits (231), Expect = 5e-17 Identities = 43/54 (79%), Positives = 48/54 (88%) Frame = -3 Query: 282 RPSMSEVLELLTSGHDSEFAKNWGMPKLISDELDDYSMVFGYEVPTDIDLEEFL 121 RPSMSEVLELLTSGHDSE A++W MPK SDELDDYSM+FGYEVP DI LE++L Sbjct: 551 RPSMSEVLELLTSGHDSEVARSWRMPKFTSDELDDYSMIFGYEVPVDIALEDYL 604 >ref|XP_006381845.1| hypothetical protein POPTR_0006s18770g [Populus trichocarpa] gi|550336603|gb|ERP59642.1| hypothetical protein POPTR_0006s18770g [Populus trichocarpa] Length = 613 Score = 93.6 bits (231), Expect = 5e-17 Identities = 43/54 (79%), Positives = 48/54 (88%) Frame = -3 Query: 282 RPSMSEVLELLTSGHDSEFAKNWGMPKLISDELDDYSMVFGYEVPTDIDLEEFL 121 RPSMSEVLELLTSGHDSE A++W MPK SDELDDYSM+FGYEVP DI LE++L Sbjct: 560 RPSMSEVLELLTSGHDSEVARSWRMPKFTSDELDDYSMIFGYEVPVDIALEDYL 613 >gb|KJB76587.1| hypothetical protein B456_012G095500 [Gossypium raimondii] Length = 611 Score = 92.8 bits (229), Expect = 9e-17 Identities = 44/54 (81%), Positives = 47/54 (87%) Frame = -3 Query: 282 RPSMSEVLELLTSGHDSEFAKNWGMPKLISDELDDYSMVFGYEVPTDIDLEEFL 121 RPSMSEVLELL +GHDS+ AK+W MPK SDELDDYSMVFGYEVPT I LEEFL Sbjct: 557 RPSMSEVLELLMTGHDSDVAKSWRMPKFTSDELDDYSMVFGYEVPTGISLEEFL 610 >ref|XP_012460813.1| PREDICTED: probable receptor-like serine/threonine-protein kinase At5g57670 [Gossypium raimondii] gi|763809684|gb|KJB76586.1| hypothetical protein B456_012G095500 [Gossypium raimondii] Length = 608 Score = 92.8 bits (229), Expect = 9e-17 Identities = 44/54 (81%), Positives = 47/54 (87%) Frame = -3 Query: 282 RPSMSEVLELLTSGHDSEFAKNWGMPKLISDELDDYSMVFGYEVPTDIDLEEFL 121 RPSMSEVLELL +GHDS+ AK+W MPK SDELDDYSMVFGYEVPT I LEEFL Sbjct: 554 RPSMSEVLELLMTGHDSDVAKSWRMPKFTSDELDDYSMVFGYEVPTGISLEEFL 607 >ref|XP_002534342.1| conserved hypothetical protein [Ricinus communis] gi|223525458|gb|EEF28040.1| conserved hypothetical protein [Ricinus communis] Length = 563 Score = 87.0 bits (214), Expect = 5e-15 Identities = 41/54 (75%), Positives = 46/54 (85%) Frame = -3 Query: 282 RPSMSEVLELLTSGHDSEFAKNWGMPKLISDELDDYSMVFGYEVPTDIDLEEFL 121 RPSMSEVLELLTSG DSE AK W MPK S++LDDYSMVFGY+VP DI LE++L Sbjct: 510 RPSMSEVLELLTSGSDSEVAKTWRMPKFTSEDLDDYSMVFGYDVPVDIVLEDYL 563 >ref|XP_012065277.1| PREDICTED: probable receptor-like serine/threonine-protein kinase At5g57670 [Jatropha curcas] gi|643737760|gb|KDP43801.1| hypothetical protein JCGZ_23009 [Jatropha curcas] Length = 590 Score = 86.7 bits (213), Expect = 6e-15 Identities = 40/54 (74%), Positives = 47/54 (87%) Frame = -3 Query: 282 RPSMSEVLELLTSGHDSEFAKNWGMPKLISDELDDYSMVFGYEVPTDIDLEEFL 121 RPSMSEVLELL +G+DS+ A++W MPK SDELDDYSMVFGYEVP DI LE++L Sbjct: 537 RPSMSEVLELLKNGNDSQVARSWRMPKFASDELDDYSMVFGYEVPADIALEDYL 590 >gb|KOM29038.1| hypothetical protein LR48_Vigan627s008700 [Vigna angularis] Length = 605 Score = 86.3 bits (212), Expect = 8e-15 Identities = 39/54 (72%), Positives = 46/54 (85%) Frame = -3 Query: 282 RPSMSEVLELLTSGHDSEFAKNWGMPKLISDELDDYSMVFGYEVPTDIDLEEFL 121 RP MSEVLELLTSG DSE K+W +PK SDELDDYSMVFGY+VP+D+ LE++L Sbjct: 552 RPPMSEVLELLTSGEDSEVGKSWRIPKFTSDELDDYSMVFGYDVPSDLSLEDYL 605 >ref|XP_006600504.1| PREDICTED: probable receptor-like serine/threonine-protein kinase At5g57670-like isoform X2 [Glycine max] gi|947053464|gb|KRH02917.1| hypothetical protein GLYMA_17G066700 [Glycine max] Length = 606 Score = 86.3 bits (212), Expect = 8e-15 Identities = 39/54 (72%), Positives = 47/54 (87%) Frame = -3 Query: 282 RPSMSEVLELLTSGHDSEFAKNWGMPKLISDELDDYSMVFGYEVPTDIDLEEFL 121 RP MSEVLELLTSG +SE K+W +PK IS+ELDDYSMVFGY+VP+DI LE++L Sbjct: 553 RPPMSEVLELLTSGQESEIGKSWRIPKFISEELDDYSMVFGYDVPSDISLEDYL 606 >ref|XP_007154802.1| hypothetical protein PHAVU_003G149100g [Phaseolus vulgaris] gi|561028156|gb|ESW26796.1| hypothetical protein PHAVU_003G149100g [Phaseolus vulgaris] Length = 605 Score = 86.3 bits (212), Expect = 8e-15 Identities = 39/54 (72%), Positives = 46/54 (85%) Frame = -3 Query: 282 RPSMSEVLELLTSGHDSEFAKNWGMPKLISDELDDYSMVFGYEVPTDIDLEEFL 121 RP MSEVLELLTSG DSE K+W +PK SDELDDYSMVFGY+VP+D+ LE++L Sbjct: 552 RPPMSEVLELLTSGEDSEVGKSWRIPKFTSDELDDYSMVFGYDVPSDLSLEDYL 605 >ref|XP_007154801.1| hypothetical protein PHAVU_003G149100g [Phaseolus vulgaris] gi|561028155|gb|ESW26795.1| hypothetical protein PHAVU_003G149100g [Phaseolus vulgaris] Length = 606 Score = 86.3 bits (212), Expect = 8e-15 Identities = 39/54 (72%), Positives = 46/54 (85%) Frame = -3 Query: 282 RPSMSEVLELLTSGHDSEFAKNWGMPKLISDELDDYSMVFGYEVPTDIDLEEFL 121 RP MSEVLELLTSG DSE K+W +PK SDELDDYSMVFGY+VP+D+ LE++L Sbjct: 553 RPPMSEVLELLTSGEDSEVGKSWRIPKFTSDELDDYSMVFGYDVPSDLSLEDYL 606 >ref|XP_003550670.1| PREDICTED: probable receptor-like serine/threonine-protein kinase At5g57670-like isoform X1 [Glycine max] gi|947053463|gb|KRH02916.1| hypothetical protein GLYMA_17G066700 [Glycine max] Length = 605 Score = 86.3 bits (212), Expect = 8e-15 Identities = 39/54 (72%), Positives = 47/54 (87%) Frame = -3 Query: 282 RPSMSEVLELLTSGHDSEFAKNWGMPKLISDELDDYSMVFGYEVPTDIDLEEFL 121 RP MSEVLELLTSG +SE K+W +PK IS+ELDDYSMVFGY+VP+DI LE++L Sbjct: 552 RPPMSEVLELLTSGQESEIGKSWRIPKFISEELDDYSMVFGYDVPSDISLEDYL 605 >ref|XP_014508011.1| PREDICTED: probable receptor-like serine/threonine-protein kinase At5g57670 [Vigna radiata var. radiata] Length = 605 Score = 85.9 bits (211), Expect = 1e-14 Identities = 39/54 (72%), Positives = 46/54 (85%) Frame = -3 Query: 282 RPSMSEVLELLTSGHDSEFAKNWGMPKLISDELDDYSMVFGYEVPTDIDLEEFL 121 RP MSEVLELLTSG DSE K+W +PK SDELDDYSMVFGY+VP+D+ LE++L Sbjct: 552 RPPMSEVLELLTSGKDSEVGKSWRIPKFTSDELDDYSMVFGYDVPSDLSLEDYL 605 >gb|KHN17563.1| Putative receptor-like serine/threonine-protein kinase [Glycine soja] Length = 605 Score = 85.9 bits (211), Expect = 1e-14 Identities = 39/54 (72%), Positives = 46/54 (85%) Frame = -3 Query: 282 RPSMSEVLELLTSGHDSEFAKNWGMPKLISDELDDYSMVFGYEVPTDIDLEEFL 121 RP MSEVLELLTSG +SE K W +PK IS+ELDDYSMVFGY+VP+DI LE++L Sbjct: 552 RPPMSEVLELLTSGQESEIGKGWRIPKFISEELDDYSMVFGYDVPSDISLEDYL 605