BLASTX nr result
ID: Zanthoxylum22_contig00029934
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00029934 (715 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB09762.1| hypothetical protein B456_001G162800 [Gossypium r... 63 2e-07 ref|XP_013441098.1| hypothetical protein MTR_2154s0010 [Medicago... 62 5e-07 >gb|KJB09762.1| hypothetical protein B456_001G162800 [Gossypium raimondii] Length = 155 Score = 62.8 bits (151), Expect = 2e-07 Identities = 25/42 (59%), Positives = 33/42 (78%) Frame = -1 Query: 679 LQDFFEAPVVNRSWKIERTDPSLVRFGLLWRVYDWIGEKGLD 554 L+DFF+APV R WK++ DP L+RFGLLWR+YD + +KG D Sbjct: 35 LKDFFDAPVFTRHWKVKSEDPELIRFGLLWRLYDEVAKKGED 76 >ref|XP_013441098.1| hypothetical protein MTR_2154s0010 [Medicago truncatula] gi|657366991|gb|KEH15123.1| hypothetical protein MTR_2154s0010 [Medicago truncatula] Length = 110 Score = 61.6 bits (148), Expect = 5e-07 Identities = 24/40 (60%), Positives = 32/40 (80%) Frame = -1 Query: 679 LQDFFEAPVVNRSWKIERTDPSLVRFGLLWRVYDWIGEKG 560 L+DFF+APV R WK++ DP L+RFGLLWR+YD + +KG Sbjct: 35 LKDFFDAPVFTRHWKVKSEDPELIRFGLLWRLYDEVAKKG 74