BLASTX nr result
ID: Zanthoxylum22_contig00029458
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00029458 (343 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO43332.1| hypothetical protein CISIN_1g020040mg [Citrus sin... 94 3e-17 ref|XP_006489638.1| PREDICTED: oxidation resistance protein 1-li... 94 3e-17 ref|XP_006420338.1| hypothetical protein CICLE_v10005395mg [Citr... 94 3e-17 ref|XP_007035247.1| TLD-domain containing nucleolar protein, put... 87 5e-15 ref|XP_009357976.1| PREDICTED: TLD domain-containing protein 2-l... 87 6e-15 ref|XP_009357975.1| PREDICTED: TLD domain-containing protein 2-l... 87 6e-15 ref|XP_008340663.1| PREDICTED: oxidation resistance protein 1 is... 87 6e-15 ref|XP_008340662.1| PREDICTED: oxidation resistance protein 1 is... 87 6e-15 ref|XP_010314768.1| PREDICTED: oxidation resistance protein 1-li... 86 8e-15 ref|XP_009334200.1| PREDICTED: uncharacterized protein LOC103927... 86 8e-15 ref|XP_009334196.1| PREDICTED: TLD domain-containing protein 2-l... 86 8e-15 ref|XP_009334194.1| PREDICTED: TLD domain-containing protein 2-l... 86 8e-15 ref|XP_006342410.1| PREDICTED: oxidation resistance protein 1-li... 86 8e-15 ref|XP_009759665.1| PREDICTED: TLD domain-containing protein 2-l... 86 1e-14 ref|XP_008245267.1| PREDICTED: oxidation resistance protein 1 [P... 85 2e-14 ref|XP_011041439.1| PREDICTED: oxidation resistance protein 1 [P... 84 3e-14 ref|XP_009594712.1| PREDICTED: TLD domain-containing protein 2-l... 84 3e-14 ref|XP_004296410.1| PREDICTED: oxidation resistance protein 1 [F... 84 4e-14 ref|XP_010089219.1| hypothetical protein L484_005711 [Morus nota... 84 5e-14 emb|CDO99307.1| unnamed protein product [Coffea canephora] 83 7e-14 >gb|KDO43332.1| hypothetical protein CISIN_1g020040mg [Citrus sinensis] Length = 332 Score = 94.4 bits (233), Expect = 3e-17 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = -1 Query: 343 DGDLLSGTSGACDTFGNLCLAHNEDFELKNVELWGFSHTSQYLT 212 DGDLLSGTSGACDTFGNLCLAHNEDFELKNVELWGFSH SQ+LT Sbjct: 289 DGDLLSGTSGACDTFGNLCLAHNEDFELKNVELWGFSHVSQHLT 332 >ref|XP_006489638.1| PREDICTED: oxidation resistance protein 1-like [Citrus sinensis] Length = 332 Score = 94.4 bits (233), Expect = 3e-17 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = -1 Query: 343 DGDLLSGTSGACDTFGNLCLAHNEDFELKNVELWGFSHTSQYLT 212 DGDLLSGTSGACDTFGNLCLAHNEDFELKNVELWGFSH SQ+LT Sbjct: 289 DGDLLSGTSGACDTFGNLCLAHNEDFELKNVELWGFSHVSQHLT 332 >ref|XP_006420338.1| hypothetical protein CICLE_v10005395mg [Citrus clementina] gi|557522211|gb|ESR33578.1| hypothetical protein CICLE_v10005395mg [Citrus clementina] Length = 332 Score = 94.4 bits (233), Expect = 3e-17 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = -1 Query: 343 DGDLLSGTSGACDTFGNLCLAHNEDFELKNVELWGFSHTSQYLT 212 DGDLLSGTSGACDTFGNLCLAHNEDFELKNVELWGFSH SQ+LT Sbjct: 289 DGDLLSGTSGACDTFGNLCLAHNEDFELKNVELWGFSHVSQHLT 332 >ref|XP_007035247.1| TLD-domain containing nucleolar protein, putative isoform 1 [Theobroma cacao] gi|508714276|gb|EOY06173.1| TLD-domain containing nucleolar protein, putative isoform 1 [Theobroma cacao] Length = 335 Score = 87.0 bits (214), Expect = 5e-15 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = -1 Query: 343 DGDLLSGTSGACDTFGNLCLAHNEDFELKNVELWGFSHTSQY 218 DGDLL+GTSG C+TFGNLCLAHNEDFELKNVELWGF+H SQY Sbjct: 293 DGDLLNGTSGPCETFGNLCLAHNEDFELKNVELWGFTHASQY 334 >ref|XP_009357976.1| PREDICTED: TLD domain-containing protein 2-like isoform X2 [Pyrus x bretschneideri] Length = 297 Score = 86.7 bits (213), Expect = 6e-15 Identities = 37/44 (84%), Positives = 42/44 (95%) Frame = -1 Query: 343 DGDLLSGTSGACDTFGNLCLAHNEDFELKNVELWGFSHTSQYLT 212 DGDLLSGTSG+C+TFGNLCLAHN +FELKNVELWGF+H S+YLT Sbjct: 254 DGDLLSGTSGSCETFGNLCLAHNGEFELKNVELWGFTHVSRYLT 297 >ref|XP_009357975.1| PREDICTED: TLD domain-containing protein 2-like isoform X1 [Pyrus x bretschneideri] Length = 316 Score = 86.7 bits (213), Expect = 6e-15 Identities = 37/44 (84%), Positives = 42/44 (95%) Frame = -1 Query: 343 DGDLLSGTSGACDTFGNLCLAHNEDFELKNVELWGFSHTSQYLT 212 DGDLLSGTSG+C+TFGNLCLAHN +FELKNVELWGF+H S+YLT Sbjct: 273 DGDLLSGTSGSCETFGNLCLAHNGEFELKNVELWGFTHVSRYLT 316 >ref|XP_008340663.1| PREDICTED: oxidation resistance protein 1 isoform X2 [Malus domestica] Length = 297 Score = 86.7 bits (213), Expect = 6e-15 Identities = 37/44 (84%), Positives = 42/44 (95%) Frame = -1 Query: 343 DGDLLSGTSGACDTFGNLCLAHNEDFELKNVELWGFSHTSQYLT 212 DGDLLSGTSG+C+TFGNLCLAHN +FELKNVELWGF+H S+YLT Sbjct: 254 DGDLLSGTSGSCETFGNLCLAHNGEFELKNVELWGFTHVSRYLT 297 >ref|XP_008340662.1| PREDICTED: oxidation resistance protein 1 isoform X1 [Malus domestica] Length = 316 Score = 86.7 bits (213), Expect = 6e-15 Identities = 37/44 (84%), Positives = 42/44 (95%) Frame = -1 Query: 343 DGDLLSGTSGACDTFGNLCLAHNEDFELKNVELWGFSHTSQYLT 212 DGDLLSGTSG+C+TFGNLCLAHN +FELKNVELWGF+H S+YLT Sbjct: 273 DGDLLSGTSGSCETFGNLCLAHNGEFELKNVELWGFTHVSRYLT 316 >ref|XP_010314768.1| PREDICTED: oxidation resistance protein 1-like [Solanum lycopersicum] Length = 330 Score = 86.3 bits (212), Expect = 8e-15 Identities = 37/44 (84%), Positives = 41/44 (93%) Frame = -1 Query: 343 DGDLLSGTSGACDTFGNLCLAHNEDFELKNVELWGFSHTSQYLT 212 DGDLLSG SG CDTFGNLCLAH+E+FELKNVELWGF+H S+YLT Sbjct: 286 DGDLLSGNSGPCDTFGNLCLAHDEEFELKNVELWGFTHASRYLT 329 >ref|XP_009334200.1| PREDICTED: uncharacterized protein LOC103927028 isoform X1 [Pyrus x bretschneideri] gi|694411695|ref|XP_009334201.1| PREDICTED: uncharacterized protein LOC103927028 isoform X1 [Pyrus x bretschneideri] Length = 406 Score = 86.3 bits (212), Expect = 8e-15 Identities = 37/44 (84%), Positives = 41/44 (93%) Frame = -1 Query: 343 DGDLLSGTSGACDTFGNLCLAHNEDFELKNVELWGFSHTSQYLT 212 DGDLLSGTSG C+TFGNLCLAHN +FELKNVELWGF+H S+YLT Sbjct: 363 DGDLLSGTSGPCETFGNLCLAHNAEFELKNVELWGFTHASRYLT 406 >ref|XP_009334196.1| PREDICTED: TLD domain-containing protein 2-like isoform X2 [Pyrus x bretschneideri] gi|694411697|ref|XP_009334202.1| PREDICTED: TLD domain-containing protein 2-like isoform X2 [Pyrus x bretschneideri] Length = 297 Score = 86.3 bits (212), Expect = 8e-15 Identities = 37/44 (84%), Positives = 41/44 (93%) Frame = -1 Query: 343 DGDLLSGTSGACDTFGNLCLAHNEDFELKNVELWGFSHTSQYLT 212 DGDLLSGTSG C+TFGNLCLAHN +FELKNVELWGF+H S+YLT Sbjct: 254 DGDLLSGTSGPCETFGNLCLAHNAEFELKNVELWGFTHASRYLT 297 >ref|XP_009334194.1| PREDICTED: TLD domain-containing protein 2-like isoform X1 [Pyrus x bretschneideri] gi|694411680|ref|XP_009334195.1| PREDICTED: TLD domain-containing protein 2-like isoform X1 [Pyrus x bretschneideri] Length = 316 Score = 86.3 bits (212), Expect = 8e-15 Identities = 37/44 (84%), Positives = 41/44 (93%) Frame = -1 Query: 343 DGDLLSGTSGACDTFGNLCLAHNEDFELKNVELWGFSHTSQYLT 212 DGDLLSGTSG C+TFGNLCLAHN +FELKNVELWGF+H S+YLT Sbjct: 273 DGDLLSGTSGPCETFGNLCLAHNAEFELKNVELWGFTHASRYLT 316 >ref|XP_006342410.1| PREDICTED: oxidation resistance protein 1-like [Solanum tuberosum] Length = 330 Score = 86.3 bits (212), Expect = 8e-15 Identities = 37/44 (84%), Positives = 41/44 (93%) Frame = -1 Query: 343 DGDLLSGTSGACDTFGNLCLAHNEDFELKNVELWGFSHTSQYLT 212 DGDLLSG SG CDTFGNLCLAH+E+FELKNVELWGF+H S+YLT Sbjct: 286 DGDLLSGNSGPCDTFGNLCLAHDEEFELKNVELWGFTHASRYLT 329 >ref|XP_009759665.1| PREDICTED: TLD domain-containing protein 2-like [Nicotiana sylvestris] Length = 320 Score = 85.9 bits (211), Expect = 1e-14 Identities = 37/44 (84%), Positives = 40/44 (90%) Frame = -1 Query: 343 DGDLLSGTSGACDTFGNLCLAHNEDFELKNVELWGFSHTSQYLT 212 DGDLLSG SG CDTFGN CLAHNE+FELKNVELWGF+H S+YLT Sbjct: 276 DGDLLSGNSGPCDTFGNSCLAHNEEFELKNVELWGFTHASRYLT 319 >ref|XP_008245267.1| PREDICTED: oxidation resistance protein 1 [Prunus mume] Length = 316 Score = 84.7 bits (208), Expect = 2e-14 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = -1 Query: 343 DGDLLSGTSGACDTFGNLCLAHNEDFELKNVELWGFSHTSQYL 215 DGDLLSGTSG C+TFGNLCLAHN +FELKNVELWGF+H S+YL Sbjct: 273 DGDLLSGTSGPCETFGNLCLAHNSEFELKNVELWGFTHASRYL 315 >ref|XP_011041439.1| PREDICTED: oxidation resistance protein 1 [Populus euphratica] Length = 332 Score = 84.3 bits (207), Expect = 3e-14 Identities = 36/44 (81%), Positives = 40/44 (90%) Frame = -1 Query: 343 DGDLLSGTSGACDTFGNLCLAHNEDFELKNVELWGFSHTSQYLT 212 DGDLL+GTSG C TFGNLCLAHN +FELKNVELWGF+H S+YLT Sbjct: 289 DGDLLNGTSGPCQTFGNLCLAHNPEFELKNVELWGFTHASKYLT 332 >ref|XP_009594712.1| PREDICTED: TLD domain-containing protein 2-like [Nicotiana tomentosiformis] Length = 319 Score = 84.3 bits (207), Expect = 3e-14 Identities = 36/44 (81%), Positives = 39/44 (88%) Frame = -1 Query: 343 DGDLLSGTSGACDTFGNLCLAHNEDFELKNVELWGFSHTSQYLT 212 DGDLLSG SG CDTFGN CLAHNE+FELKNVELWGF+H S+Y T Sbjct: 275 DGDLLSGNSGPCDTFGNSCLAHNEEFELKNVELWGFTHASRYFT 318 >ref|XP_004296410.1| PREDICTED: oxidation resistance protein 1 [Fragaria vesca subsp. vesca] Length = 311 Score = 84.0 bits (206), Expect = 4e-14 Identities = 36/44 (81%), Positives = 40/44 (90%) Frame = -1 Query: 343 DGDLLSGTSGACDTFGNLCLAHNEDFELKNVELWGFSHTSQYLT 212 DGDLLSGTSG C+TFGNLCLAH DFELKNVELWGF+H S+YL+ Sbjct: 268 DGDLLSGTSGPCETFGNLCLAHKPDFELKNVELWGFTHASRYLS 311 >ref|XP_010089219.1| hypothetical protein L484_005711 [Morus notabilis] gi|587847081|gb|EXB37497.1| hypothetical protein L484_005711 [Morus notabilis] Length = 318 Score = 83.6 bits (205), Expect = 5e-14 Identities = 35/44 (79%), Positives = 40/44 (90%) Frame = -1 Query: 343 DGDLLSGTSGACDTFGNLCLAHNEDFELKNVELWGFSHTSQYLT 212 DGDLL+GTSG C+TFGN+CLAH +FELKNVELWGF+H SQYLT Sbjct: 275 DGDLLNGTSGPCETFGNMCLAHKPEFELKNVELWGFTHASQYLT 318 >emb|CDO99307.1| unnamed protein product [Coffea canephora] Length = 340 Score = 83.2 bits (204), Expect = 7e-14 Identities = 34/44 (77%), Positives = 43/44 (97%) Frame = -1 Query: 343 DGDLLSGTSGACDTFGNLCLAHNEDFELKNVELWGFSHTSQYLT 212 DG+LL+G+SGAC+TFGNLCLAH+E+FEL+NVELWGF+H S+YLT Sbjct: 297 DGELLTGSSGACETFGNLCLAHDEEFELRNVELWGFTHASRYLT 340