BLASTX nr result
ID: Zanthoxylum22_contig00029303
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00029303 (277 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006465605.1| PREDICTED: uncharacterized protein LOC102611... 58 2e-06 ref|XP_012073356.1| PREDICTED: uncharacterized protein LOC105634... 57 7e-06 gb|KDO56889.1| hypothetical protein CISIN_1g001075mg [Citrus sin... 57 7e-06 gb|KDO56888.1| hypothetical protein CISIN_1g001075mg [Citrus sin... 57 7e-06 ref|XP_006426970.1| hypothetical protein CICLE_v10024750mg [Citr... 57 7e-06 >ref|XP_006465605.1| PREDICTED: uncharacterized protein LOC102611914 [Citrus sinensis] Length = 1121 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 277 ELLLLSAFPEMDYAFKQVREEKHRFGEFKE 188 ELLLLSAFPE++YAFKQV EEKHRFGE+KE Sbjct: 1091 ELLLLSAFPELNYAFKQVHEEKHRFGEYKE 1120 >ref|XP_012073356.1| PREDICTED: uncharacterized protein LOC105634990 isoform X4 [Jatropha curcas] Length = 1139 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -1 Query: 277 ELLLLSAFPEMDYAFKQVREEKHRFGEFK 191 ELLLLSAFPE+DY FKQ+ EEKHRFGEFK Sbjct: 1109 ELLLLSAFPELDYVFKQLHEEKHRFGEFK 1137 >gb|KDO56889.1| hypothetical protein CISIN_1g001075mg [Citrus sinensis] Length = 1163 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -1 Query: 277 ELLLLSAFPEMDYAFKQVREEKHRFGEFKE 188 ELLLLS FPE++YAFKQV EEKHRFGE+KE Sbjct: 1133 ELLLLSTFPELNYAFKQVHEEKHRFGEYKE 1162 >gb|KDO56888.1| hypothetical protein CISIN_1g001075mg [Citrus sinensis] Length = 1121 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -1 Query: 277 ELLLLSAFPEMDYAFKQVREEKHRFGEFKE 188 ELLLLS FPE++YAFKQV EEKHRFGE+KE Sbjct: 1091 ELLLLSTFPELNYAFKQVHEEKHRFGEYKE 1120 >ref|XP_006426970.1| hypothetical protein CICLE_v10024750mg [Citrus clementina] gi|557528960|gb|ESR40210.1| hypothetical protein CICLE_v10024750mg [Citrus clementina] Length = 1121 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -1 Query: 277 ELLLLSAFPEMDYAFKQVREEKHRFGEFKE 188 ELLLLS FPE++YAFKQV EEKHRFGE+KE Sbjct: 1091 ELLLLSTFPELNYAFKQVHEEKHRFGEYKE 1120