BLASTX nr result
ID: Zanthoxylum22_contig00029247
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00029247 (307 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008720768.1| hypothetical protein HMPREF1541_08226 [Cyphe... 60 5e-07 >ref|XP_008720768.1| hypothetical protein HMPREF1541_08226 [Cyphellophora europaea CBS 101466] gi|568114614|gb|ETN37236.1| hypothetical protein HMPREF1541_08226 [Cyphellophora europaea CBS 101466] Length = 59 Score = 60.5 bits (145), Expect = 5e-07 Identities = 28/55 (50%), Positives = 41/55 (74%) Frame = -2 Query: 234 LEDLRAALRKAFPELSPEDFQTAAGDRSKLSKIVAEKKSISEEDATKEVDAVWAA 70 +E RAALR F +++PE+F+ AG+R L K+V EK +SEE+A KEVDA++A+ Sbjct: 4 VEKTRAALRAKFDKITPEEFKNTAGNRDALYKLVVEKHGLSEEEAKKEVDAIFAS 58