BLASTX nr result
ID: Zanthoxylum22_contig00029089
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00029089 (431 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO73490.1| hypothetical protein CISIN_1g003047mg [Citrus sin... 71 4e-10 ref|XP_006453084.1| hypothetical protein CICLE_v10007427mg [Citr... 71 4e-10 >gb|KDO73490.1| hypothetical protein CISIN_1g003047mg [Citrus sinensis] Length = 854 Score = 70.9 bits (172), Expect = 4e-10 Identities = 36/43 (83%), Positives = 38/43 (88%) Frame = -1 Query: 131 MDSRDSTQSTDAVNNSGEDDGGVLSVTASLAKEAALYFHSRQF 3 MDSRDSTQST A N SGEDD GVLSVTA+LAKEAALYF SR+F Sbjct: 1 MDSRDSTQSTAAGNTSGEDDSGVLSVTATLAKEAALYFQSRKF 43 >ref|XP_006453084.1| hypothetical protein CICLE_v10007427mg [Citrus clementina] gi|568840927|ref|XP_006474416.1| PREDICTED: CCR4-NOT transcription complex subunit 10-like [Citrus sinensis] gi|557556310|gb|ESR66324.1| hypothetical protein CICLE_v10007427mg [Citrus clementina] Length = 854 Score = 70.9 bits (172), Expect = 4e-10 Identities = 36/43 (83%), Positives = 38/43 (88%) Frame = -1 Query: 131 MDSRDSTQSTDAVNNSGEDDGGVLSVTASLAKEAALYFHSRQF 3 MDSRDSTQST A N SGEDD GVLSVTA+LAKEAALYF SR+F Sbjct: 1 MDSRDSTQSTAAGNTSGEDDSGVLSVTATLAKEAALYFQSRKF 43