BLASTX nr result
ID: Zanthoxylum22_contig00028827
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00028827 (344 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006445821.1| hypothetical protein CICLE_v10015516mg [Citr... 80 6e-13 >ref|XP_006445821.1| hypothetical protein CICLE_v10015516mg [Citrus clementina] gi|568879545|ref|XP_006492714.1| PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic subunit-like isoform X1 [Citrus sinensis] gi|557548432|gb|ESR59061.1| hypothetical protein CICLE_v10015516mg [Citrus clementina] gi|641844114|gb|KDO63009.1| hypothetical protein CISIN_1g016098mg [Citrus sinensis] Length = 395 Score = 80.1 bits (196), Expect = 6e-13 Identities = 40/55 (72%), Positives = 45/55 (81%) Frame = +2 Query: 2 EHLITSYDASRHKLDMMFLAATAYRLVCVFGVFLKFKVYTFDYGGGWMAKSCKMD 166 EHLIT Y+ASRHKL M+ AATAY+LV VF FLKFK+Y +DYGGG AKSCKMD Sbjct: 341 EHLITFYNASRHKLGML-PAATAYQLVYVFRAFLKFKIYAYDYGGGRKAKSCKMD 394