BLASTX nr result
ID: Zanthoxylum22_contig00028730
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00028730 (345 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO66704.1| hypothetical protein CISIN_1g023099mg [Citrus sin... 62 1e-07 >gb|KDO66704.1| hypothetical protein CISIN_1g023099mg [Citrus sinensis] gi|641847827|gb|KDO66705.1| hypothetical protein CISIN_1g023099mg [Citrus sinensis] Length = 211 Score = 62.4 bits (150), Expect = 1e-07 Identities = 38/68 (55%), Positives = 42/68 (61%), Gaps = 9/68 (13%) Frame = -3 Query: 178 MVITCLLETGPNPR---TFFPPQRYICLTIS*A------YLYF*VCQMLRIVTFYSTHLP 26 MVITCLLE R + F + + L I + LYF VCQMLRIVTFYST LP Sbjct: 1 MVITCLLEMVLESRYKASHFIVKSFPSLGILFSDNFFRHILYFQVCQMLRIVTFYSTQLP 60 Query: 25 GPNYHCRE 2 GPNYHCRE Sbjct: 61 GPNYHCRE 68