BLASTX nr result
ID: Zanthoxylum22_contig00028625
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00028625 (514 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006494011.1| PREDICTED: putative disease resistance prote... 59 1e-06 >ref|XP_006494011.1| PREDICTED: putative disease resistance protein At3g14460-like [Citrus sinensis] Length = 1422 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -1 Query: 514 GQEWAIIAHIPCVNIDGKFIFDP*EEALCLF 422 GQEW IAH+PCVNIDGKFI+DP EEALC F Sbjct: 1392 GQEWPKIAHVPCVNIDGKFIYDPEEEALCPF 1422