BLASTX nr result
ID: Zanthoxylum22_contig00028571
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00028571 (287 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO64095.1| hypothetical protein CISIN_1g011714mg [Citrus sin... 101 2e-19 gb|KDO38519.1| hypothetical protein CISIN_1g045820mg, partial [C... 65 3e-08 ref|XP_006429582.1| hypothetical protein CICLE_v10013314mg, part... 59 1e-06 >gb|KDO64095.1| hypothetical protein CISIN_1g011714mg [Citrus sinensis] Length = 479 Score = 101 bits (252), Expect = 2e-19 Identities = 51/81 (62%), Positives = 65/81 (80%), Gaps = 2/81 (2%) Frame = -1 Query: 245 SLLLSHSFIFTNTNRRNRSIVPKFNKL--FATATLSAEQSLDFNESPRNLQAQKFINTIK 72 SL+ S+SFIFTNTNRRN + +P+FNKL FA A+LS +SLD E+PR+LQAQ+F++ IK Sbjct: 3 SLVPSNSFIFTNTNRRNHNKIPQFNKLVVFAAASLSTAESLDLKENPRSLQAQRFVDRIK 62 Query: 71 ALPLKERSDKCNNIKKDGINW 9 A PLKER D ++IKKDG NW Sbjct: 63 ASPLKERIDIFDSIKKDGTNW 83 >gb|KDO38519.1| hypothetical protein CISIN_1g045820mg, partial [Citrus sinensis] Length = 225 Score = 64.7 bits (156), Expect = 3e-08 Identities = 30/46 (65%), Positives = 37/46 (80%) Frame = -1 Query: 146 SAEQSLDFNESPRNLQAQKFINTIKALPLKERSDKCNNIKKDGINW 9 SA +SLD E+PR+LQAQ+F++ IKA PLKER D N+IKKDG NW Sbjct: 25 SAAESLDLKENPRSLQAQRFVDKIKASPLKERIDIFNSIKKDGTNW 70 >ref|XP_006429582.1| hypothetical protein CICLE_v10013314mg, partial [Citrus clementina] gi|557531639|gb|ESR42822.1| hypothetical protein CICLE_v10013314mg, partial [Citrus clementina] Length = 438 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/42 (64%), Positives = 34/42 (80%) Frame = -1 Query: 134 SLDFNESPRNLQAQKFINTIKALPLKERSDKCNNIKKDGINW 9 SLD E+PR+LQAQ+F++ IKA PLKER D ++IKKDG NW Sbjct: 1 SLDLKENPRSLQAQRFVDRIKASPLKERIDIFDSIKKDGTNW 42