BLASTX nr result
ID: Zanthoxylum22_contig00028108
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00028108 (268 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO74124.1| hypothetical protein CISIN_1g020495mg [Citrus sin... 63 8e-08 ref|XP_006451925.1| hypothetical protein CICLE_v10008977mg [Citr... 63 8e-08 ref|XP_006451924.1| hypothetical protein CICLE_v10008977mg [Citr... 63 8e-08 ref|XP_006464718.1| PREDICTED: ribosome biogenesis protein BRX1 ... 60 6e-07 >gb|KDO74124.1| hypothetical protein CISIN_1g020495mg [Citrus sinensis] Length = 325 Score = 63.2 bits (152), Expect = 8e-08 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -3 Query: 101 MGQKRKRSETLEPTKKDDSITEERPKRTLLGWK 3 MG+KRK +E +EPTKKDDS+TEERPKRTLLGWK Sbjct: 1 MGKKRKHTEIIEPTKKDDSVTEERPKRTLLGWK 33 >ref|XP_006451925.1| hypothetical protein CICLE_v10008977mg [Citrus clementina] gi|557555151|gb|ESR65165.1| hypothetical protein CICLE_v10008977mg [Citrus clementina] Length = 219 Score = 63.2 bits (152), Expect = 8e-08 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -3 Query: 101 MGQKRKRSETLEPTKKDDSITEERPKRTLLGWK 3 MG+KRK +E +EPTKKDDS+TEERPKRTLLGWK Sbjct: 1 MGKKRKHTEIIEPTKKDDSVTEERPKRTLLGWK 33 >ref|XP_006451924.1| hypothetical protein CICLE_v10008977mg [Citrus clementina] gi|557555150|gb|ESR65164.1| hypothetical protein CICLE_v10008977mg [Citrus clementina] gi|641855336|gb|KDO74122.1| hypothetical protein CISIN_1g020495mg [Citrus sinensis] Length = 312 Score = 63.2 bits (152), Expect = 8e-08 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -3 Query: 101 MGQKRKRSETLEPTKKDDSITEERPKRTLLGWK 3 MG+KRK +E +EPTKKDDS+TEERPKRTLLGWK Sbjct: 1 MGKKRKHTEIIEPTKKDDSVTEERPKRTLLGWK 33 >ref|XP_006464718.1| PREDICTED: ribosome biogenesis protein BRX1 homolog [Citrus sinensis] Length = 312 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -3 Query: 101 MGQKRKRSETLEPTKKDDSITEERPKRTLLGWK 3 MG+KRK +E +EPTKKDDS+TE RPKRTLLGWK Sbjct: 1 MGKKRKHTEIIEPTKKDDSLTEGRPKRTLLGWK 33