BLASTX nr result
ID: Zanthoxylum22_contig00028076
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00028076 (304 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011022138.1| PREDICTED: uncharacterized transporter YBR28... 65 3e-08 ref|XP_006382981.1| hypothetical protein POPTR_0005s10230g [Popu... 65 3e-08 ref|XP_006382980.1| hypothetical protein POPTR_0005s10230g [Popu... 65 3e-08 ref|XP_002306421.2| auxin efflux carrier family protein [Populus... 65 3e-08 ref|XP_006382976.1| hypothetical protein POPTR_0005s10230g [Popu... 65 3e-08 ref|XP_006388075.1| hypothetical protein POPTR_0365s00230g [Popu... 65 3e-08 ref|XP_011096969.1| PREDICTED: uncharacterized transporter C5D6.... 64 4e-08 ref|XP_009420837.1| PREDICTED: uncharacterized protein LOC104000... 64 4e-08 ref|XP_012844878.1| PREDICTED: uncharacterized protein LOC105964... 64 6e-08 gb|EYU30841.1| hypothetical protein MIMGU_mgv1a0088071mg, partia... 64 6e-08 ref|XP_012845067.1| PREDICTED: uncharacterized protein LOC105965... 63 8e-08 ref|XP_009759350.1| PREDICTED: uncharacterized transporter C5D6.... 63 8e-08 ref|XP_009759349.1| PREDICTED: uncharacterized transporter C5D6.... 63 8e-08 ref|XP_009779996.1| PREDICTED: uncharacterized protein LOC104229... 63 8e-08 ref|XP_009614501.1| PREDICTED: uncharacterized protein LOC104107... 63 8e-08 ref|XP_009614500.1| PREDICTED: uncharacterized protein LOC104107... 63 8e-08 ref|XP_009607642.1| PREDICTED: uncharacterized transporter C5D6.... 63 8e-08 gb|EYU30838.1| hypothetical protein MIMGU_mgv1a007822mg [Erythra... 63 8e-08 ref|XP_006467106.1| PREDICTED: uncharacterized transporter YBR28... 63 1e-07 ref|XP_006425254.1| hypothetical protein CICLE_v10025741mg [Citr... 63 1e-07 >ref|XP_011022138.1| PREDICTED: uncharacterized transporter YBR287W-like [Populus euphratica] gi|743824064|ref|XP_011022139.1| PREDICTED: uncharacterized transporter YBR287W-like [Populus euphratica] Length = 418 Score = 64.7 bits (156), Expect = 3e-08 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -2 Query: 303 VAQEECSFLFLWTYLVASVALTAWSTVFMWILS 205 V QEECS LFLWTYLVA++ALTAWST+FMWILS Sbjct: 386 VGQEECSVLFLWTYLVAALALTAWSTIFMWILS 418 >ref|XP_006382981.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa] gi|550338536|gb|ERP60778.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa] Length = 370 Score = 64.7 bits (156), Expect = 3e-08 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -2 Query: 303 VAQEECSFLFLWTYLVASVALTAWSTVFMWILS 205 V QEECS LFLWTYLVA++ALTAWST+FMWILS Sbjct: 338 VGQEECSVLFLWTYLVAALALTAWSTIFMWILS 370 >ref|XP_006382980.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa] gi|550338535|gb|ERP60777.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa] Length = 266 Score = 64.7 bits (156), Expect = 3e-08 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -2 Query: 303 VAQEECSFLFLWTYLVASVALTAWSTVFMWILS 205 V QEECS LFLWTYLVA++ALTAWST+FMWILS Sbjct: 234 VGQEECSVLFLWTYLVAALALTAWSTIFMWILS 266 >ref|XP_002306421.2| auxin efflux carrier family protein [Populus trichocarpa] gi|566170511|ref|XP_006382977.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa] gi|566170513|ref|XP_006382978.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa] gi|566170515|ref|XP_006382979.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa] gi|550338531|gb|EEE93417.2| auxin efflux carrier family protein [Populus trichocarpa] gi|550338532|gb|ERP60774.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa] gi|550338533|gb|ERP60775.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa] gi|550338534|gb|ERP60776.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa] Length = 418 Score = 64.7 bits (156), Expect = 3e-08 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -2 Query: 303 VAQEECSFLFLWTYLVASVALTAWSTVFMWILS 205 V QEECS LFLWTYLVA++ALTAWST+FMWILS Sbjct: 386 VGQEECSVLFLWTYLVAALALTAWSTIFMWILS 418 >ref|XP_006382976.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa] gi|566170521|ref|XP_006382982.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa] gi|550338530|gb|ERP60773.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa] gi|550338537|gb|ERP60779.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa] Length = 344 Score = 64.7 bits (156), Expect = 3e-08 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -2 Query: 303 VAQEECSFLFLWTYLVASVALTAWSTVFMWILS 205 V QEECS LFLWTYLVA++ALTAWST+FMWILS Sbjct: 312 VGQEECSVLFLWTYLVAALALTAWSTIFMWILS 344 >ref|XP_006388075.1| hypothetical protein POPTR_0365s00230g [Populus trichocarpa] gi|550309392|gb|ERP46989.1| hypothetical protein POPTR_0365s00230g [Populus trichocarpa] Length = 428 Score = 64.7 bits (156), Expect = 3e-08 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -2 Query: 303 VAQEECSFLFLWTYLVASVALTAWSTVFMWILS 205 V QEECS LFLWTYLVA++ALTAWST+FMWILS Sbjct: 396 VGQEECSVLFLWTYLVAALALTAWSTIFMWILS 428 >ref|XP_011096969.1| PREDICTED: uncharacterized transporter C5D6.04-like isoform X1 [Sesamum indicum] Length = 411 Score = 63.9 bits (154), Expect = 4e-08 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -2 Query: 303 VAQEECSFLFLWTYLVASVALTAWSTVFMWILS 205 VAQEECS LFLWTYLVA++ALT WSTVFMWIL+ Sbjct: 379 VAQEECSVLFLWTYLVAALALTGWSTVFMWILT 411 >ref|XP_009420837.1| PREDICTED: uncharacterized protein LOC104000492 [Musa acuminata subsp. malaccensis] Length = 412 Score = 63.9 bits (154), Expect = 4e-08 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -2 Query: 303 VAQEECSFLFLWTYLVASVALTAWSTVFMWILS 205 VAQEECS +FLWTYL+A+V+LT WSTVFMWILS Sbjct: 380 VAQEECSVIFLWTYLIAAVSLTVWSTVFMWILS 412 >ref|XP_012844878.1| PREDICTED: uncharacterized protein LOC105964917 [Erythranthe guttatus] Length = 410 Score = 63.5 bits (153), Expect = 6e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -2 Query: 303 VAQEECSFLFLWTYLVASVALTAWSTVFMWILS 205 VAQEECS LFLWTYLVA+ ALT WSTVFMWIL+ Sbjct: 378 VAQEECSILFLWTYLVAAFALTGWSTVFMWILT 410 >gb|EYU30841.1| hypothetical protein MIMGU_mgv1a0088071mg, partial [Erythranthe guttata] Length = 283 Score = 63.5 bits (153), Expect = 6e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -2 Query: 303 VAQEECSFLFLWTYLVASVALTAWSTVFMWILS 205 VAQEECS LFLWTYLVA+ ALT WSTVFMWIL+ Sbjct: 251 VAQEECSILFLWTYLVAAFALTGWSTVFMWILT 283 >ref|XP_012845067.1| PREDICTED: uncharacterized protein LOC105965098 [Erythranthe guttatus] Length = 402 Score = 63.2 bits (152), Expect = 8e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -2 Query: 303 VAQEECSFLFLWTYLVASVALTAWSTVFMWILS 205 VAQEECS LFLWTYLVA+ A+T WSTVFMWILS Sbjct: 370 VAQEECSSLFLWTYLVAAFAITGWSTVFMWILS 402 >ref|XP_009759350.1| PREDICTED: uncharacterized transporter C5D6.04-like isoform X2 [Nicotiana sylvestris] Length = 414 Score = 63.2 bits (152), Expect = 8e-08 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -2 Query: 303 VAQEECSFLFLWTYLVASVALTAWSTVFMWILS 205 VAQEECS LF+WTYLVA++ALT WSTVFMW+LS Sbjct: 382 VAQEECSVLFMWTYLVAALALTIWSTVFMWLLS 414 >ref|XP_009759349.1| PREDICTED: uncharacterized transporter C5D6.04-like isoform X1 [Nicotiana sylvestris] Length = 415 Score = 63.2 bits (152), Expect = 8e-08 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -2 Query: 303 VAQEECSFLFLWTYLVASVALTAWSTVFMWILS 205 VAQEECS LF+WTYLVA++ALT WSTVFMW+LS Sbjct: 383 VAQEECSVLFMWTYLVAALALTIWSTVFMWLLS 415 >ref|XP_009779996.1| PREDICTED: uncharacterized protein LOC104229115 [Nicotiana sylvestris] gi|698453635|ref|XP_009779997.1| PREDICTED: uncharacterized protein LOC104229115 [Nicotiana sylvestris] Length = 419 Score = 63.2 bits (152), Expect = 8e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -2 Query: 303 VAQEECSFLFLWTYLVASVALTAWSTVFMWILS 205 VAQEECS LFLWTYLVA+ ALT WSTVFMW+LS Sbjct: 387 VAQEECSVLFLWTYLVAAFALTIWSTVFMWLLS 419 >ref|XP_009614501.1| PREDICTED: uncharacterized protein LOC104107409 isoform X2 [Nicotiana tomentosiformis] Length = 370 Score = 63.2 bits (152), Expect = 8e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -2 Query: 303 VAQEECSFLFLWTYLVASVALTAWSTVFMWILS 205 VAQEECS LFLWTYLVA+ ALT WSTVFMW+LS Sbjct: 338 VAQEECSVLFLWTYLVAAFALTIWSTVFMWLLS 370 >ref|XP_009614500.1| PREDICTED: uncharacterized protein LOC104107409 isoform X1 [Nicotiana tomentosiformis] Length = 416 Score = 63.2 bits (152), Expect = 8e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -2 Query: 303 VAQEECSFLFLWTYLVASVALTAWSTVFMWILS 205 VAQEECS LFLWTYLVA+ ALT WSTVFMW+LS Sbjct: 384 VAQEECSVLFLWTYLVAAFALTIWSTVFMWLLS 416 >ref|XP_009607642.1| PREDICTED: uncharacterized transporter C5D6.04 [Nicotiana tomentosiformis] gi|697107612|ref|XP_009607643.1| PREDICTED: uncharacterized transporter C5D6.04 [Nicotiana tomentosiformis] Length = 414 Score = 63.2 bits (152), Expect = 8e-08 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -2 Query: 303 VAQEECSFLFLWTYLVASVALTAWSTVFMWILS 205 VAQEECS LF+WTYLVA++ALT WSTVFMW+LS Sbjct: 382 VAQEECSVLFMWTYLVAALALTIWSTVFMWLLS 414 >gb|EYU30838.1| hypothetical protein MIMGU_mgv1a007822mg [Erythranthe guttata] Length = 394 Score = 63.2 bits (152), Expect = 8e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -2 Query: 303 VAQEECSFLFLWTYLVASVALTAWSTVFMWILS 205 VAQEECS LFLWTYLVA+ A+T WSTVFMWILS Sbjct: 362 VAQEECSSLFLWTYLVAAFAITGWSTVFMWILS 394 >ref|XP_006467106.1| PREDICTED: uncharacterized transporter YBR287W-like [Citrus sinensis] Length = 423 Score = 62.8 bits (151), Expect = 1e-07 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -2 Query: 303 VAQEECSFLFLWTYLVASVALTAWSTVFMWILS 205 VAQEECS LFLWTYLVA++ALT WS VFMWILS Sbjct: 391 VAQEECSVLFLWTYLVAALALTGWSMVFMWILS 423 >ref|XP_006425254.1| hypothetical protein CICLE_v10025741mg [Citrus clementina] gi|557527244|gb|ESR38494.1| hypothetical protein CICLE_v10025741mg [Citrus clementina] Length = 299 Score = 62.8 bits (151), Expect = 1e-07 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -2 Query: 303 VAQEECSFLFLWTYLVASVALTAWSTVFMWILS 205 VAQEECS LFLWTYLVA++ALT WS VFMWILS Sbjct: 267 VAQEECSVLFLWTYLVAALALTGWSMVFMWILS 299