BLASTX nr result
ID: Zanthoxylum22_contig00028056
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00028056 (366 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO42978.1| hypothetical protein CISIN_1g027078mg [Citrus sin... 67 5e-09 ref|XP_006427582.1| hypothetical protein CICLE_v10026425mg [Citr... 67 5e-09 ref|XP_010245550.1| PREDICTED: DCN1-like protein 4 isoform X3 [N... 64 4e-08 ref|XP_010245549.1| PREDICTED: DCN1-like protein 4 isoform X2 [N... 64 4e-08 ref|XP_010245547.1| PREDICTED: DCN1-like protein 4 isoform X1 [N... 64 4e-08 gb|KNA18558.1| hypothetical protein SOVF_069600 [Spinacia oleracea] 62 1e-07 ref|XP_010691620.1| PREDICTED: DCN1-like protein 4 [Beta vulgari... 62 1e-07 ref|XP_011020637.1| PREDICTED: DCN1-like protein 4 isoform X1 [P... 62 2e-07 ref|XP_002299268.1| hypothetical protein POPTR_0001s14740g [Popu... 62 2e-07 ref|XP_002303837.1| hypothetical protein POPTR_0003s17870g [Popu... 62 2e-07 ref|XP_012442800.1| PREDICTED: DCN1-like protein 4 isoform X1 [G... 61 4e-07 ref|XP_007023386.1| Domain of Uncharacterized protein function (... 61 4e-07 gb|KJB35265.1| hypothetical protein B456_006G107200 [Gossypium r... 60 5e-07 gb|KJB35263.1| hypothetical protein B456_006G107200 [Gossypium r... 60 5e-07 ref|XP_012485041.1| PREDICTED: DCN1-like protein 4 isoform X4 [G... 60 5e-07 ref|XP_012485038.1| PREDICTED: DCN1-like protein 4 isoform X1 [G... 60 5e-07 ref|XP_010063550.1| PREDICTED: DCN1-like protein 4 isoform X1 [E... 59 1e-06 gb|KCW70789.1| hypothetical protein EUGRSUZ_F03949 [Eucalyptus g... 59 1e-06 ref|XP_010265676.1| PREDICTED: DCN1-like protein 4 [Nelumbo nuci... 59 1e-06 ref|XP_011034505.1| PREDICTED: DCN1-like protein 4 [Populus euph... 59 2e-06 >gb|KDO42978.1| hypothetical protein CISIN_1g027078mg [Citrus sinensis] Length = 228 Score = 67.0 bits (162), Expect = 5e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 364 ISFPDFNNYDPNLAWPLILDNFVEWMIAKQ 275 ISFPDFNNYDPNLAWPL+LDNFVEWM AKQ Sbjct: 198 ISFPDFNNYDPNLAWPLVLDNFVEWMKAKQ 227 >ref|XP_006427582.1| hypothetical protein CICLE_v10026425mg [Citrus clementina] gi|567869923|ref|XP_006427583.1| hypothetical protein CICLE_v10026425mg [Citrus clementina] gi|567869925|ref|XP_006427584.1| hypothetical protein CICLE_v10026425mg [Citrus clementina] gi|568821517|ref|XP_006465206.1| PREDICTED: DCN1-like protein 4-like isoform X1 [Citrus sinensis] gi|568821519|ref|XP_006465207.1| PREDICTED: DCN1-like protein 4-like isoform X2 [Citrus sinensis] gi|568821521|ref|XP_006465208.1| PREDICTED: DCN1-like protein 4-like isoform X3 [Citrus sinensis] gi|557529572|gb|ESR40822.1| hypothetical protein CICLE_v10026425mg [Citrus clementina] gi|557529573|gb|ESR40823.1| hypothetical protein CICLE_v10026425mg [Citrus clementina] gi|557529574|gb|ESR40824.1| hypothetical protein CICLE_v10026425mg [Citrus clementina] gi|641823581|gb|KDO42979.1| hypothetical protein CISIN_1g027078mg [Citrus sinensis] gi|641823582|gb|KDO42980.1| hypothetical protein CISIN_1g027078mg [Citrus sinensis] gi|641823583|gb|KDO42981.1| hypothetical protein CISIN_1g027078mg [Citrus sinensis] gi|641823584|gb|KDO42982.1| hypothetical protein CISIN_1g027078mg [Citrus sinensis] Length = 226 Score = 67.0 bits (162), Expect = 5e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 364 ISFPDFNNYDPNLAWPLILDNFVEWMIAKQ 275 ISFPDFNNYDPNLAWPL+LDNFVEWM AKQ Sbjct: 196 ISFPDFNNYDPNLAWPLVLDNFVEWMKAKQ 225 >ref|XP_010245550.1| PREDICTED: DCN1-like protein 4 isoform X3 [Nelumbo nucifera] Length = 212 Score = 63.9 bits (154), Expect = 4e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 364 ISFPDFNNYDPNLAWPLILDNFVEWMIAKQ 275 ISFPD +NYDP+LAWPLILDNFVEWMIAKQ Sbjct: 182 ISFPDLSNYDPDLAWPLILDNFVEWMIAKQ 211 >ref|XP_010245549.1| PREDICTED: DCN1-like protein 4 isoform X2 [Nelumbo nucifera] Length = 231 Score = 63.9 bits (154), Expect = 4e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 364 ISFPDFNNYDPNLAWPLILDNFVEWMIAKQ 275 ISFPD +NYDP+LAWPLILDNFVEWMIAKQ Sbjct: 201 ISFPDLSNYDPDLAWPLILDNFVEWMIAKQ 230 >ref|XP_010245547.1| PREDICTED: DCN1-like protein 4 isoform X1 [Nelumbo nucifera] gi|720091853|ref|XP_010245548.1| PREDICTED: DCN1-like protein 4 isoform X1 [Nelumbo nucifera] Length = 232 Score = 63.9 bits (154), Expect = 4e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 364 ISFPDFNNYDPNLAWPLILDNFVEWMIAKQ 275 ISFPD +NYDP+LAWPLILDNFVEWMIAKQ Sbjct: 202 ISFPDLSNYDPDLAWPLILDNFVEWMIAKQ 231 >gb|KNA18558.1| hypothetical protein SOVF_069600 [Spinacia oleracea] Length = 229 Score = 62.4 bits (150), Expect = 1e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -3 Query: 364 ISFPDFNNYDPNLAWPLILDNFVEWMIAKQ 275 ISFPDF+NYDP+LAWPLILDNFV+WM AKQ Sbjct: 199 ISFPDFSNYDPDLAWPLILDNFVDWMKAKQ 228 >ref|XP_010691620.1| PREDICTED: DCN1-like protein 4 [Beta vulgaris subsp. vulgaris] gi|870848785|gb|KMT01074.1| hypothetical protein BVRB_9g223290 [Beta vulgaris subsp. vulgaris] Length = 229 Score = 62.4 bits (150), Expect = 1e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -3 Query: 364 ISFPDFNNYDPNLAWPLILDNFVEWMIAKQ 275 ISFPDF+NYDP+LAWPLILDNFV+WM AKQ Sbjct: 199 ISFPDFSNYDPDLAWPLILDNFVDWMQAKQ 228 >ref|XP_011020637.1| PREDICTED: DCN1-like protein 4 isoform X1 [Populus euphratica] Length = 232 Score = 61.6 bits (148), Expect = 2e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 364 ISFPDFNNYDPNLAWPLILDNFVEWMIAKQ 275 ISFPDF+NYDP LAWPLILDNFVEWM AK+ Sbjct: 202 ISFPDFSNYDPELAWPLILDNFVEWMRAKR 231 >ref|XP_002299268.1| hypothetical protein POPTR_0001s14740g [Populus trichocarpa] gi|222846526|gb|EEE84073.1| hypothetical protein POPTR_0001s14740g [Populus trichocarpa] Length = 232 Score = 61.6 bits (148), Expect = 2e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 364 ISFPDFNNYDPNLAWPLILDNFVEWMIAKQ 275 ISFPDF+NYDP LAWPLILDNFVEWM AK+ Sbjct: 202 ISFPDFSNYDPELAWPLILDNFVEWMRAKR 231 >ref|XP_002303837.1| hypothetical protein POPTR_0003s17870g [Populus trichocarpa] gi|566163253|ref|XP_006385925.1| hypothetical protein POPTR_0003s17870g [Populus trichocarpa] gi|222841269|gb|EEE78816.1| hypothetical protein POPTR_0003s17870g [Populus trichocarpa] gi|550343413|gb|ERP63722.1| hypothetical protein POPTR_0003s17870g [Populus trichocarpa] Length = 232 Score = 61.6 bits (148), Expect = 2e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 364 ISFPDFNNYDPNLAWPLILDNFVEWMIAKQ 275 ISFPDF+NYDP LAWPLILDNFVEWM AK+ Sbjct: 202 ISFPDFSNYDPELAWPLILDNFVEWMRAKR 231 >ref|XP_012442800.1| PREDICTED: DCN1-like protein 4 isoform X1 [Gossypium raimondii] gi|763789419|gb|KJB56415.1| hypothetical protein B456_009G124900 [Gossypium raimondii] gi|763789420|gb|KJB56416.1| hypothetical protein B456_009G124900 [Gossypium raimondii] gi|763789421|gb|KJB56417.1| hypothetical protein B456_009G124900 [Gossypium raimondii] Length = 234 Score = 60.8 bits (146), Expect = 4e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -3 Query: 364 ISFPDFNNYDPNLAWPLILDNFVEWMIAKQ 275 ISFPD +NYDP+LAWPL+LDNFVEWM AKQ Sbjct: 204 ISFPDLSNYDPDLAWPLVLDNFVEWMQAKQ 233 >ref|XP_007023386.1| Domain of Uncharacterized protein function (DUF298) isoform 1 [Theobroma cacao] gi|590616020|ref|XP_007023387.1| Domain of Uncharacterized protein function (DUF298) isoform 1 [Theobroma cacao] gi|508778752|gb|EOY26008.1| Domain of Uncharacterized protein function (DUF298) isoform 1 [Theobroma cacao] gi|508778753|gb|EOY26009.1| Domain of Uncharacterized protein function (DUF298) isoform 1 [Theobroma cacao] Length = 232 Score = 60.8 bits (146), Expect = 4e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -3 Query: 364 ISFPDFNNYDPNLAWPLILDNFVEWMIAKQ 275 ISFPD NNY+P+LAWPL+LDNFVEWM AKQ Sbjct: 202 ISFPDLNNYNPDLAWPLVLDNFVEWMQAKQ 231 >gb|KJB35265.1| hypothetical protein B456_006G107200 [Gossypium raimondii] Length = 176 Score = 60.5 bits (145), Expect = 5e-07 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -3 Query: 364 ISFPDFNNYDPNLAWPLILDNFVEWMIAKQ 275 ISFPDF+NY+P+LAWPLILDNFVEWM +KQ Sbjct: 146 ISFPDFSNYNPDLAWPLILDNFVEWMQSKQ 175 >gb|KJB35263.1| hypothetical protein B456_006G107200 [Gossypium raimondii] Length = 210 Score = 60.5 bits (145), Expect = 5e-07 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -3 Query: 364 ISFPDFNNYDPNLAWPLILDNFVEWMIAKQ 275 ISFPDF+NY+P+LAWPLILDNFVEWM +KQ Sbjct: 180 ISFPDFSNYNPDLAWPLILDNFVEWMQSKQ 209 >ref|XP_012485041.1| PREDICTED: DCN1-like protein 4 isoform X4 [Gossypium raimondii] gi|763768046|gb|KJB35261.1| hypothetical protein B456_006G107200 [Gossypium raimondii] Length = 194 Score = 60.5 bits (145), Expect = 5e-07 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -3 Query: 364 ISFPDFNNYDPNLAWPLILDNFVEWMIAKQ 275 ISFPDF+NY+P+LAWPLILDNFVEWM +KQ Sbjct: 164 ISFPDFSNYNPDLAWPLILDNFVEWMQSKQ 193 >ref|XP_012485038.1| PREDICTED: DCN1-like protein 4 isoform X1 [Gossypium raimondii] gi|763768044|gb|KJB35259.1| hypothetical protein B456_006G107200 [Gossypium raimondii] Length = 232 Score = 60.5 bits (145), Expect = 5e-07 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -3 Query: 364 ISFPDFNNYDPNLAWPLILDNFVEWMIAKQ 275 ISFPDF+NY+P+LAWPLILDNFVEWM +KQ Sbjct: 202 ISFPDFSNYNPDLAWPLILDNFVEWMQSKQ 231 >ref|XP_010063550.1| PREDICTED: DCN1-like protein 4 isoform X1 [Eucalyptus grandis] Length = 232 Score = 59.3 bits (142), Expect = 1e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -3 Query: 364 ISFPDFNNYDPNLAWPLILDNFVEWMIAKQ 275 ISFPDF+NY+P LAWPLILDNFVEWM KQ Sbjct: 202 ISFPDFSNYNPELAWPLILDNFVEWMREKQ 231 >gb|KCW70789.1| hypothetical protein EUGRSUZ_F03949 [Eucalyptus grandis] Length = 301 Score = 59.3 bits (142), Expect = 1e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -3 Query: 364 ISFPDFNNYDPNLAWPLILDNFVEWMIAKQ 275 ISFPDF+NY+P LAWPLILDNFVEWM KQ Sbjct: 271 ISFPDFSNYNPELAWPLILDNFVEWMREKQ 300 >ref|XP_010265676.1| PREDICTED: DCN1-like protein 4 [Nelumbo nucifera] gi|720031007|ref|XP_010265677.1| PREDICTED: DCN1-like protein 4 [Nelumbo nucifera] Length = 231 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -3 Query: 364 ISFPDFNNYDPNLAWPLILDNFVEWMIAKQ 275 ISFPD +NYDP+LAWPLILDNFVEWM A Q Sbjct: 201 ISFPDLSNYDPDLAWPLILDNFVEWMRAMQ 230 >ref|XP_011034505.1| PREDICTED: DCN1-like protein 4 [Populus euphratica] gi|743873855|ref|XP_011034506.1| PREDICTED: DCN1-like protein 4 [Populus euphratica] Length = 232 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/29 (86%), Positives = 25/29 (86%) Frame = -3 Query: 364 ISFPDFNNYDPNLAWPLILDNFVEWMIAK 278 ISFPD NYDP LAWPLILDNFVEWM AK Sbjct: 202 ISFPDLGNYDPELAWPLILDNFVEWMRAK 230