BLASTX nr result
ID: Zanthoxylum22_contig00027957
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00027957 (332 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010550985.1| PREDICTED: pollen-specific leucine-rich repe... 67 5e-09 emb|CBI39526.3| unnamed protein product [Vitis vinifera] 66 9e-09 ref|XP_002512423.1| chloroplast-targeted copper chaperone, putat... 66 9e-09 ref|XP_002279364.1| PREDICTED: brain acid soluble protein 1 [Vit... 66 9e-09 emb|CAN73618.1| hypothetical protein VITISV_004114 [Vitis vinifera] 66 9e-09 gb|KDO56231.1| hypothetical protein CISIN_1g016666mg [Citrus sin... 65 2e-08 ref|XP_006472121.1| PREDICTED: small heat shock protein hspG3-li... 65 2e-08 ref|XP_006433404.1| hypothetical protein CICLE_v10001480mg [Citr... 65 2e-08 ref|XP_010684412.1| PREDICTED: pollen-specific leucine-rich repe... 65 2e-08 ref|XP_008223175.1| PREDICTED: uncharacterized protein LOC103322... 64 3e-08 ref|XP_013618105.1| PREDICTED: putative uncharacterized protein ... 64 4e-08 ref|XP_009129874.1| PREDICTED: basic salivary proline-rich prote... 64 4e-08 emb|CDY05566.1| BnaA02g31250D [Brassica napus] 64 4e-08 emb|CDY25027.1| BnaC02g39810D [Brassica napus] 64 4e-08 ref|XP_006288034.1| hypothetical protein CARUB_v10001264mg [Caps... 64 6e-08 ref|XP_010098292.1| hypothetical protein L484_023540 [Morus nota... 63 8e-08 ref|XP_010938427.1| PREDICTED: RE1-silencing transcription facto... 63 8e-08 ref|XP_010493986.1| PREDICTED: WAS/WASL-interacting protein fami... 63 8e-08 ref|XP_010421585.1| PREDICTED: WAS/WASL-interacting protein fami... 63 8e-08 gb|KFK26492.1| hypothetical protein AALP_AA8G256100 [Arabis alpina] 63 8e-08 >ref|XP_010550985.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like protein 1 [Tarenaya hassleriana] Length = 318 Score = 67.0 bits (162), Expect = 5e-09 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = -3 Query: 108 YQEHLKYKTWVFRVSIHCEGCKKKVKKFLTNIDGVY 1 Y E L+Y TWV RVSIHCEGCK+K+KK LTNIDGVY Sbjct: 33 YPEPLRYTTWVLRVSIHCEGCKRKIKKLLTNIDGVY 68 >emb|CBI39526.3| unnamed protein product [Vitis vinifera] Length = 129 Score = 66.2 bits (160), Expect = 9e-09 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = -3 Query: 102 EHLKYKTWVFRVSIHCEGCKKKVKKFLTNIDGVY 1 E LKYKTWV +VSIHCEGCKKKVKK L NIDGVY Sbjct: 16 EPLKYKTWVLKVSIHCEGCKKKVKKILQNIDGVY 49 >ref|XP_002512423.1| chloroplast-targeted copper chaperone, putative [Ricinus communis] gi|223548384|gb|EEF49875.1| chloroplast-targeted copper chaperone, putative [Ricinus communis] Length = 384 Score = 66.2 bits (160), Expect = 9e-09 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -3 Query: 96 LKYKTWVFRVSIHCEGCKKKVKKFLTNIDGVY 1 LKYKTWV +VSIHCEGCK+KVKK LTNIDGVY Sbjct: 33 LKYKTWVLKVSIHCEGCKRKVKKILTNIDGVY 64 >ref|XP_002279364.1| PREDICTED: brain acid soluble protein 1 [Vitis vinifera] Length = 350 Score = 66.2 bits (160), Expect = 9e-09 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = -3 Query: 102 EHLKYKTWVFRVSIHCEGCKKKVKKFLTNIDGVY 1 E LKYKTWV +VSIHCEGCKKKVKK L NIDGVY Sbjct: 16 EPLKYKTWVLKVSIHCEGCKKKVKKILQNIDGVY 49 >emb|CAN73618.1| hypothetical protein VITISV_004114 [Vitis vinifera] Length = 350 Score = 66.2 bits (160), Expect = 9e-09 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = -3 Query: 102 EHLKYKTWVFRVSIHCEGCKKKVKKFLTNIDGVY 1 E LKYKTWV +VSIHCEGCKKKVKK L NIDGVY Sbjct: 16 EPLKYKTWVLKVSIHCEGCKKKVKKILQNIDGVY 49 >gb|KDO56231.1| hypothetical protein CISIN_1g016666mg [Citrus sinensis] Length = 385 Score = 65.5 bits (158), Expect = 2e-08 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = -3 Query: 105 QEHLKYKTWVFRVSIHCEGCKKKVKKFLTNIDGVY 1 QE LK KTWV RVSIHCEGCK+KV K LTNIDGVY Sbjct: 30 QEQLKCKTWVLRVSIHCEGCKRKVHKILTNIDGVY 64 >ref|XP_006472121.1| PREDICTED: small heat shock protein hspG3-like [Citrus sinensis] Length = 216 Score = 65.5 bits (158), Expect = 2e-08 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = -3 Query: 105 QEHLKYKTWVFRVSIHCEGCKKKVKKFLTNIDGVY 1 QE LK KTWV RVSIHCEGCK+KV K LTNIDGVY Sbjct: 30 QEQLKCKTWVLRVSIHCEGCKRKVHKILTNIDGVY 64 >ref|XP_006433404.1| hypothetical protein CICLE_v10001480mg [Citrus clementina] gi|568836089|ref|XP_006472081.1| PREDICTED: cylicin-2-like isoform X1 [Citrus sinensis] gi|557535526|gb|ESR46644.1| hypothetical protein CICLE_v10001480mg [Citrus clementina] Length = 383 Score = 65.5 bits (158), Expect = 2e-08 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = -3 Query: 105 QEHLKYKTWVFRVSIHCEGCKKKVKKFLTNIDGVY 1 QE LK KTWV RVSIHCEGCK+KV K LTNIDGVY Sbjct: 30 QEQLKCKTWVLRVSIHCEGCKRKVHKILTNIDGVY 64 >ref|XP_010684412.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like protein 1 [Beta vulgaris subsp. vulgaris] gi|870854298|gb|KMT06095.1| hypothetical protein BVRB_7g164120 [Beta vulgaris subsp. vulgaris] Length = 417 Score = 65.1 bits (157), Expect = 2e-08 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = -3 Query: 105 QEHLKYKTWVFRVSIHCEGCKKKVKKFLTNIDGVY 1 QE LKYKTW+ RV IHCEGCKKKVKK L IDGVY Sbjct: 9 QEPLKYKTWILRVQIHCEGCKKKVKKILQKIDGVY 43 >ref|XP_008223175.1| PREDICTED: uncharacterized protein LOC103322997 [Prunus mume] Length = 294 Score = 64.3 bits (155), Expect = 3e-08 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -3 Query: 102 EHLKYKTWVFRVSIHCEGCKKKVKKFLTNIDGVY 1 E LKY+TW+ RVSIHCEGCK+KVKK L NIDGVY Sbjct: 12 ESLKYQTWILRVSIHCEGCKRKVKKVLQNIDGVY 45 >ref|XP_013618105.1| PREDICTED: putative uncharacterized protein DDB_G0284695 [Brassica oleracea var. oleracea] Length = 358 Score = 63.9 bits (154), Expect = 4e-08 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = -3 Query: 108 YQEHLKYKTWVFRVSIHCEGCKKKVKKFLTNIDGVY 1 YQE L+Y TWV RVSIHCEGCK+K+KK L+ I+GVY Sbjct: 35 YQEPLRYTTWVLRVSIHCEGCKRKIKKLLSKIEGVY 70 >ref|XP_009129874.1| PREDICTED: basic salivary proline-rich protein 2 [Brassica rapa] Length = 359 Score = 63.9 bits (154), Expect = 4e-08 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = -3 Query: 108 YQEHLKYKTWVFRVSIHCEGCKKKVKKFLTNIDGVY 1 YQE L+Y TWV RVSIHCEGCK+K+KK L+ I+GVY Sbjct: 35 YQEPLRYTTWVLRVSIHCEGCKRKIKKLLSKIEGVY 70 >emb|CDY05566.1| BnaA02g31250D [Brassica napus] Length = 357 Score = 63.9 bits (154), Expect = 4e-08 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = -3 Query: 108 YQEHLKYKTWVFRVSIHCEGCKKKVKKFLTNIDGVY 1 YQE L+Y TWV RVSIHCEGCK+K+KK L+ I+GVY Sbjct: 35 YQEPLRYTTWVLRVSIHCEGCKRKIKKLLSKIEGVY 70 >emb|CDY25027.1| BnaC02g39810D [Brassica napus] Length = 361 Score = 63.9 bits (154), Expect = 4e-08 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = -3 Query: 108 YQEHLKYKTWVFRVSIHCEGCKKKVKKFLTNIDGVY 1 YQE L+Y TWV RVSIHCEGCK+K+KK L+ I+GVY Sbjct: 35 YQEPLRYTTWVLRVSIHCEGCKRKIKKLLSKIEGVY 70 >ref|XP_006288034.1| hypothetical protein CARUB_v10001264mg [Capsella rubella] gi|482556740|gb|EOA20932.1| hypothetical protein CARUB_v10001264mg [Capsella rubella] Length = 358 Score = 63.5 bits (153), Expect = 6e-08 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = -3 Query: 108 YQEHLKYKTWVFRVSIHCEGCKKKVKKFLTNIDGVY 1 Y E L+Y TWV RVSIHCEGCK+K+KK L+ IDGVY Sbjct: 25 YPEPLRYNTWVLRVSIHCEGCKRKIKKILSKIDGVY 60 >ref|XP_010098292.1| hypothetical protein L484_023540 [Morus notabilis] gi|587885958|gb|EXB74796.1| hypothetical protein L484_023540 [Morus notabilis] Length = 315 Score = 63.2 bits (152), Expect = 8e-08 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -3 Query: 105 QEHLKYKTWVFRVSIHCEGCKKKVKKFLTNIDGVY 1 QE LKY+TWV +VSIHCEGCK+KVKK L IDGVY Sbjct: 10 QESLKYQTWVLKVSIHCEGCKRKVKKVLQKIDGVY 44 >ref|XP_010938427.1| PREDICTED: RE1-silencing transcription factor-like [Elaeis guineensis] Length = 355 Score = 63.2 bits (152), Expect = 8e-08 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -3 Query: 102 EHLKYKTWVFRVSIHCEGCKKKVKKFLTNIDGVY 1 E LKYKTWV +VSIHCEGCKKKVK+ L +IDGVY Sbjct: 9 EPLKYKTWVLKVSIHCEGCKKKVKRILQSIDGVY 42 >ref|XP_010493986.1| PREDICTED: WAS/WASL-interacting protein family member 1-like [Camelina sativa] Length = 345 Score = 63.2 bits (152), Expect = 8e-08 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = -3 Query: 108 YQEHLKYKTWVFRVSIHCEGCKKKVKKFLTNIDGVY 1 Y E L+Y TWV RVSIHCEGCK+K+KK L+ IDGVY Sbjct: 25 YPEPLRYTTWVLRVSIHCEGCKRKIKKILSKIDGVY 60 >ref|XP_010421585.1| PREDICTED: WAS/WASL-interacting protein family member 1-like [Camelina sativa] Length = 352 Score = 63.2 bits (152), Expect = 8e-08 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = -3 Query: 108 YQEHLKYKTWVFRVSIHCEGCKKKVKKFLTNIDGVY 1 Y E L+Y TWV RVSIHCEGCK+K+KK L+ IDGVY Sbjct: 25 YPEPLRYTTWVLRVSIHCEGCKRKIKKILSKIDGVY 60 >gb|KFK26492.1| hypothetical protein AALP_AA8G256100 [Arabis alpina] Length = 352 Score = 63.2 bits (152), Expect = 8e-08 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = -3 Query: 108 YQEHLKYKTWVFRVSIHCEGCKKKVKKFLTNIDGVY 1 Y E L+Y TWV RVSIHCEGCK+K+KK L+ IDGVY Sbjct: 22 YPEPLRYTTWVLRVSIHCEGCKRKIKKILSKIDGVY 57