BLASTX nr result
ID: Zanthoxylum22_contig00027870
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00027870 (392 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006473401.1| PREDICTED: B3 domain-containing protein REM1... 89 1e-15 ref|XP_006434884.1| hypothetical protein CICLE_v10001063mg [Citr... 89 1e-15 ref|XP_011017261.1| PREDICTED: B3 domain-containing protein REM1... 58 3e-06 ref|XP_006386516.1| hypothetical protein POPTR_0002s13140g [Popu... 58 3e-06 gb|KJB14544.1| hypothetical protein B456_002G130300, partial [Go... 57 4e-06 ref|XP_012466546.1| PREDICTED: B3 domain-containing protein REM1... 57 4e-06 gb|KHG05314.1| B3 domain-containing REM16 -like protein [Gossypi... 57 4e-06 >ref|XP_006473401.1| PREDICTED: B3 domain-containing protein REM16-like isoform X1 [Citrus sinensis] gi|568838819|ref|XP_006473402.1| PREDICTED: B3 domain-containing protein REM16-like isoform X2 [Citrus sinensis] Length = 467 Score = 89.0 bits (219), Expect = 1e-15 Identities = 48/87 (55%), Positives = 51/87 (58%), Gaps = 17/87 (19%) Frame = -2 Query: 391 YLTLENQHVILRLNERTWITRFQFCKSRCSGGLSGGWKNF-----------------XXX 263 YLTLENQ VILRLNE+TWITRFQFCK RCSGGLSGGWKNF Sbjct: 378 YLTLENQDVILRLNEKTWITRFQFCKPRCSGGLSGGWKNFAVDNHLDEFDVCVFSPDNPG 437 Query: 262 XXXXXXXXXXXXXVNDVIPLTEVAPAS 182 VN V+PLT+VAPAS Sbjct: 438 TKPMVLNVSIFRVVNAVVPLTQVAPAS 464 >ref|XP_006434884.1| hypothetical protein CICLE_v10001063mg [Citrus clementina] gi|557537006|gb|ESR48124.1| hypothetical protein CICLE_v10001063mg [Citrus clementina] gi|641865687|gb|KDO84372.1| hypothetical protein CISIN_1g042953mg [Citrus sinensis] Length = 467 Score = 89.0 bits (219), Expect = 1e-15 Identities = 48/87 (55%), Positives = 51/87 (58%), Gaps = 17/87 (19%) Frame = -2 Query: 391 YLTLENQHVILRLNERTWITRFQFCKSRCSGGLSGGWKNF-----------------XXX 263 YLTLENQ VILRLNE+TWITRFQFCK RCSGGLSGGWKNF Sbjct: 378 YLTLENQDVILRLNEKTWITRFQFCKPRCSGGLSGGWKNFAVDNHLDEFDVCVFGPDNPG 437 Query: 262 XXXXXXXXXXXXXVNDVIPLTEVAPAS 182 VN V+PLT+VAPAS Sbjct: 438 TKPMVLNVSIFRVVNAVVPLTQVAPAS 464 >ref|XP_011017261.1| PREDICTED: B3 domain-containing protein REM16-like [Populus euphratica] Length = 345 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/40 (60%), Positives = 31/40 (77%) Frame = -2 Query: 391 YLTLENQHVILRLNERTWITRFQFCKSRCSGGLSGGWKNF 272 + TLE + VILR+ E TW T+F +CKS+ SGGLS GW+NF Sbjct: 272 FRTLEKKDVILRMKENTWNTKFLYCKSKNSGGLSSGWRNF 311 >ref|XP_006386516.1| hypothetical protein POPTR_0002s13140g [Populus trichocarpa] gi|550344906|gb|ERP64313.1| hypothetical protein POPTR_0002s13140g [Populus trichocarpa] Length = 183 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/40 (60%), Positives = 31/40 (77%) Frame = -2 Query: 391 YLTLENQHVILRLNERTWITRFQFCKSRCSGGLSGGWKNF 272 + TLE + VILR+ E TW T+F +CKS+ SGGLS GW+NF Sbjct: 110 FRTLEKKDVILRMKENTWNTKFLYCKSKNSGGLSSGWRNF 149 >gb|KJB14544.1| hypothetical protein B456_002G130300, partial [Gossypium raimondii] Length = 427 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/40 (62%), Positives = 31/40 (77%) Frame = -2 Query: 391 YLTLENQHVILRLNERTWITRFQFCKSRCSGGLSGGWKNF 272 YL +N VILR+N+RTW TRF + +SR GGLSGGW+NF Sbjct: 327 YLPKDNADVILRMNKRTWKTRFYYHRSRDCGGLSGGWRNF 366 >ref|XP_012466546.1| PREDICTED: B3 domain-containing protein REM16 [Gossypium raimondii] gi|823133388|ref|XP_012466548.1| PREDICTED: B3 domain-containing protein REM16 [Gossypium raimondii] gi|823133390|ref|XP_012466549.1| PREDICTED: B3 domain-containing protein REM16 [Gossypium raimondii] gi|763747104|gb|KJB14543.1| hypothetical protein B456_002G130300 [Gossypium raimondii] gi|763747106|gb|KJB14545.1| hypothetical protein B456_002G130300 [Gossypium raimondii] Length = 396 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/40 (62%), Positives = 31/40 (77%) Frame = -2 Query: 391 YLTLENQHVILRLNERTWITRFQFCKSRCSGGLSGGWKNF 272 YL +N VILR+N+RTW TRF + +SR GGLSGGW+NF Sbjct: 296 YLPKDNADVILRMNKRTWKTRFYYHRSRDCGGLSGGWRNF 335 >gb|KHG05314.1| B3 domain-containing REM16 -like protein [Gossypium arboreum] Length = 376 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/40 (62%), Positives = 31/40 (77%) Frame = -2 Query: 391 YLTLENQHVILRLNERTWITRFQFCKSRCSGGLSGGWKNF 272 YL +N VILR+N+RTW TRF + +SR GGLSGGW+NF Sbjct: 276 YLPKDNADVILRMNKRTWKTRFYYHRSRDCGGLSGGWRNF 315