BLASTX nr result
ID: Zanthoxylum22_contig00026936
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00026936 (353 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO42998.1| hypothetical protein CISIN_1g023991mg [Citrus sin... 57 5e-06 ref|XP_006465196.1| PREDICTED: probable CCR4-associated factor 1... 57 5e-06 ref|XP_006427595.1| hypothetical protein CICLE_v10026260mg [Citr... 57 5e-06 >gb|KDO42998.1| hypothetical protein CISIN_1g023991mg [Citrus sinensis] Length = 274 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -2 Query: 97 MSLLPMGDAIQIREVWNDNLEQEFDLILKIVD 2 MSLLP GD+IQIREVW+DNLE EFDLI KIVD Sbjct: 1 MSLLPKGDSIQIREVWSDNLELEFDLIRKIVD 32 >ref|XP_006465196.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Citrus sinensis] Length = 274 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -2 Query: 97 MSLLPMGDAIQIREVWNDNLEQEFDLILKIVD 2 MSLLP GD+IQIREVW+DNLE EFDLI KIVD Sbjct: 1 MSLLPKGDSIQIREVWSDNLELEFDLIRKIVD 32 >ref|XP_006427595.1| hypothetical protein CICLE_v10026260mg [Citrus clementina] gi|567869949|ref|XP_006427596.1| hypothetical protein CICLE_v10026260mg [Citrus clementina] gi|557529585|gb|ESR40835.1| hypothetical protein CICLE_v10026260mg [Citrus clementina] gi|557529586|gb|ESR40836.1| hypothetical protein CICLE_v10026260mg [Citrus clementina] Length = 274 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -2 Query: 97 MSLLPMGDAIQIREVWNDNLEQEFDLILKIVD 2 MSLLP GD+IQIREVW+DNLE EFDLI KIVD Sbjct: 1 MSLLPKGDSIQIREVWSDNLELEFDLIRKIVD 32