BLASTX nr result
ID: Zanthoxylum22_contig00026524
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00026524 (310 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009785597.1| PREDICTED: myb-related protein 306-like [Nic... 59 1e-06 ref|XP_009594207.1| PREDICTED: myb-related protein 306 [Nicotian... 58 2e-06 >ref|XP_009785597.1| PREDICTED: myb-related protein 306-like [Nicotiana sylvestris] Length = 339 Score = 58.9 bits (141), Expect = 1e-06 Identities = 30/45 (66%), Positives = 35/45 (77%), Gaps = 4/45 (8%) Frame = -3 Query: 308 ALCEALSLDKTRTSPNFPLPE----SKPYALSAENISKLLQNWMK 186 ALCEALSLDK+ + PN P+P+ S YA SAENIS+LLQNWMK Sbjct: 158 ALCEALSLDKSNSPPNNPIPQPVQSSCTYASSAENISRLLQNWMK 202 >ref|XP_009594207.1| PREDICTED: myb-related protein 306 [Nicotiana tomentosiformis] Length = 349 Score = 58.2 bits (139), Expect = 2e-06 Identities = 30/45 (66%), Positives = 35/45 (77%), Gaps = 4/45 (8%) Frame = -3 Query: 308 ALCEALSLDKTRTSPNFPLPE----SKPYALSAENISKLLQNWMK 186 ALCEALSLDK+ + PN P+P+ S YA SAENIS+LLQNWMK Sbjct: 158 ALCEALSLDKSDSPPNNPIPQPVQSSCTYASSAENISRLLQNWMK 202