BLASTX nr result
ID: Zanthoxylum22_contig00026221
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00026221 (252 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO64974.1| hypothetical protein CISIN_1g004469mg [Citrus sin... 70 6e-10 gb|KDO64973.1| hypothetical protein CISIN_1g004469mg [Citrus sin... 70 6e-10 gb|KDO64972.1| hypothetical protein CISIN_1g004469mg [Citrus sin... 70 6e-10 ref|XP_006465891.1| PREDICTED: inter-alpha-trypsin inhibitor hea... 70 6e-10 ref|XP_006426697.1| hypothetical protein CICLE_v10024980mg [Citr... 70 6e-10 >gb|KDO64974.1| hypothetical protein CISIN_1g004469mg [Citrus sinensis] gi|641846091|gb|KDO64975.1| hypothetical protein CISIN_1g004469mg [Citrus sinensis] Length = 591 Score = 70.1 bits (170), Expect = 6e-10 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -1 Query: 114 MGSEFESCVDYGLTLSKRIYYGKELGSGRVVVPPGMTR 1 M SEFESCV+YGL LSKRIYYGKE GSGR V+PPGMTR Sbjct: 1 MASEFESCVNYGLNLSKRIYYGKEPGSGRAVMPPGMTR 38 >gb|KDO64973.1| hypothetical protein CISIN_1g004469mg [Citrus sinensis] Length = 591 Score = 70.1 bits (170), Expect = 6e-10 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -1 Query: 114 MGSEFESCVDYGLTLSKRIYYGKELGSGRVVVPPGMTR 1 M SEFESCV+YGL LSKRIYYGKE GSGR V+PPGMTR Sbjct: 1 MASEFESCVNYGLNLSKRIYYGKEPGSGRAVMPPGMTR 38 >gb|KDO64972.1| hypothetical protein CISIN_1g004469mg [Citrus sinensis] Length = 751 Score = 70.1 bits (170), Expect = 6e-10 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -1 Query: 114 MGSEFESCVDYGLTLSKRIYYGKELGSGRVVVPPGMTR 1 M SEFESCV+YGL LSKRIYYGKE GSGR V+PPGMTR Sbjct: 1 MASEFESCVNYGLNLSKRIYYGKEPGSGRAVMPPGMTR 38 >ref|XP_006465891.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like [Citrus sinensis] Length = 751 Score = 70.1 bits (170), Expect = 6e-10 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -1 Query: 114 MGSEFESCVDYGLTLSKRIYYGKELGSGRVVVPPGMTR 1 M SEFESCV+YGL LSKRIYYGKE GSGR V+PPGMTR Sbjct: 1 MASEFESCVNYGLNLSKRIYYGKEPGSGRAVMPPGMTR 38 >ref|XP_006426697.1| hypothetical protein CICLE_v10024980mg [Citrus clementina] gi|557528687|gb|ESR39937.1| hypothetical protein CICLE_v10024980mg [Citrus clementina] Length = 742 Score = 70.1 bits (170), Expect = 6e-10 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -1 Query: 114 MGSEFESCVDYGLTLSKRIYYGKELGSGRVVVPPGMTR 1 M SEFESCV+YGL LSKRIYYGKE GSGR V+PPGMTR Sbjct: 1 MASEFESCVNYGLNLSKRIYYGKEPGSGRAVMPPGMTR 38