BLASTX nr result
ID: Zanthoxylum22_contig00026217
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00026217 (280 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006432556.1| hypothetical protein CICLE_v10000254mg [Citr... 71 4e-10 >ref|XP_006432556.1| hypothetical protein CICLE_v10000254mg [Citrus clementina] gi|568834454|ref|XP_006471343.1| PREDICTED: replication protein A 70 kDa DNA-binding subunit C-like [Citrus sinensis] gi|557534678|gb|ESR45796.1| hypothetical protein CICLE_v10000254mg [Citrus clementina] Length = 858 Score = 70.9 bits (172), Expect = 4e-10 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = -1 Query: 139 MAVNLTEGAISLICNGDVATDNHLIPVLQVTDLKLVVSK 23 MA+NLTEGAISLIC GDV TDNHL+PVLQV DLKLVVSK Sbjct: 1 MAINLTEGAISLICKGDVTTDNHLMPVLQVMDLKLVVSK 39