BLASTX nr result
ID: Zanthoxylum22_contig00025083
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00025083 (321 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006430029.1| hypothetical protein CICLE_v10013003mg [Citr... 63 7e-08 >ref|XP_006430029.1| hypothetical protein CICLE_v10013003mg [Citrus clementina] gi|557532086|gb|ESR43269.1| hypothetical protein CICLE_v10013003mg [Citrus clementina] Length = 154 Score = 63.2 bits (152), Expect = 7e-08 Identities = 34/53 (64%), Positives = 39/53 (73%) Frame = -2 Query: 167 MRESL*AHY*HDQTSLAKPERSTYPESDLFGLGFSSISGPSIGTPRLTDGEDE 9 M +SL H QTSLAKPE+ST P SD+FGLG +S SGPS+GTPRL EDE Sbjct: 1 MGKSLLTH----QTSLAKPEKSTCPGSDIFGLGKASTSGPSMGTPRLLGAEDE 49