BLASTX nr result
ID: Zanthoxylum22_contig00024404
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00024404 (265 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO63065.1| hypothetical protein CISIN_1g004476mg [Citrus sin... 78 2e-12 ref|XP_006471158.1| PREDICTED: U4/U6.U5 tri-snRNP-associated pro... 78 2e-12 ref|XP_006431678.1| hypothetical protein CICLE_v10000233mg [Citr... 75 3e-11 >gb|KDO63065.1| hypothetical protein CISIN_1g004476mg [Citrus sinensis] gi|641844171|gb|KDO63066.1| hypothetical protein CISIN_1g004476mg [Citrus sinensis] Length = 751 Score = 78.2 bits (191), Expect = 2e-12 Identities = 37/50 (74%), Positives = 41/50 (82%) Frame = -2 Query: 243 MDRSDRDESPVREYAEEGAYDENLDRNRTEHRSMDRNKIRSRVDEKDHRS 94 MDR DESPVREY++EGAYD NLDRN TEHRS +RNK +SR DEKD RS Sbjct: 1 MDRFGPDESPVREYSDEGAYDNNLDRNETEHRSKERNKGKSRGDEKDRRS 50 >ref|XP_006471158.1| PREDICTED: U4/U6.U5 tri-snRNP-associated protein 1-like [Citrus sinensis] Length = 878 Score = 78.2 bits (191), Expect = 2e-12 Identities = 37/50 (74%), Positives = 41/50 (82%) Frame = -2 Query: 243 MDRSDRDESPVREYAEEGAYDENLDRNRTEHRSMDRNKIRSRVDEKDHRS 94 MDR DESPVREY++EGAYD NLDRN TEHRS +RNK +SR DEKD RS Sbjct: 1 MDRFGPDESPVREYSDEGAYDNNLDRNETEHRSKERNKGKSRGDEKDRRS 50 >ref|XP_006431678.1| hypothetical protein CICLE_v10000233mg [Citrus clementina] gi|567878241|ref|XP_006431679.1| hypothetical protein CICLE_v10000233mg [Citrus clementina] gi|557533800|gb|ESR44918.1| hypothetical protein CICLE_v10000233mg [Citrus clementina] gi|557533801|gb|ESR44919.1| hypothetical protein CICLE_v10000233mg [Citrus clementina] Length = 878 Score = 74.7 bits (182), Expect = 3e-11 Identities = 35/50 (70%), Positives = 41/50 (82%) Frame = -2 Query: 243 MDRSDRDESPVREYAEEGAYDENLDRNRTEHRSMDRNKIRSRVDEKDHRS 94 MDR DESPVREY++EGAYD+NLD+N T HRS +RNK +SR DEKD RS Sbjct: 1 MDRFGPDESPVREYSDEGAYDDNLDQNETVHRSKERNKGKSRGDEKDRRS 50