BLASTX nr result
ID: Zanthoxylum22_contig00024223
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00024223 (340 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007028967.1| Myb-like HTH transcriptional regulator famil... 57 7e-06 >ref|XP_007028967.1| Myb-like HTH transcriptional regulator family protein, putative isoform 1 [Theobroma cacao] gi|508717572|gb|EOY09469.1| Myb-like HTH transcriptional regulator family protein, putative isoform 1 [Theobroma cacao] Length = 423 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/40 (62%), Positives = 33/40 (82%) Frame = -2 Query: 333 LNPENLEIVPEDDPPLFNLEDIEVSVAENSGNSHFPSKIS 214 L ++L+I P D P F+LED+EVS+AENSG++HFPSKIS Sbjct: 384 LKKQDLDITPFDHDPSFSLEDVEVSIAENSGDAHFPSKIS 423