BLASTX nr result
ID: Zanthoxylum22_contig00024154
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00024154 (428 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO73757.1| hypothetical protein CISIN_1g004566mg [Citrus sin... 119 1e-24 ref|XP_006474564.1| PREDICTED: AT-rich interactive domain-contai... 119 1e-24 ref|XP_006452906.1| hypothetical protein CICLE_v10007563mg [Citr... 119 1e-24 ref|XP_002277324.2| PREDICTED: AT-rich interactive domain-contai... 113 5e-23 ref|XP_010047433.1| PREDICTED: AT-rich interactive domain-contai... 113 5e-23 emb|CBI27746.3| unnamed protein product [Vitis vinifera] 113 5e-23 emb|CAN61485.1| hypothetical protein VITISV_043023 [Vitis vinifera] 113 5e-23 ref|XP_011039905.1| PREDICTED: AT-rich interactive domain-contai... 113 6e-23 ref|XP_009782074.1| PREDICTED: AT-rich interactive domain-contai... 113 6e-23 ref|XP_006381551.1| hypothetical protein POPTR_0006s13780g [Popu... 113 6e-23 ref|XP_012077118.1| PREDICTED: AT-rich interactive domain-contai... 112 1e-22 ref|XP_002516200.1| DNA binding protein, putative [Ricinus commu... 112 1e-22 ref|XP_004488152.1| PREDICTED: AT-rich interactive domain-contai... 112 1e-22 ref|XP_010096547.1| AT-rich interactive domain-containing protei... 111 2e-22 ref|XP_009604965.1| PREDICTED: AT-rich interactive domain-contai... 111 2e-22 ref|XP_011003461.1| PREDICTED: AT-rich interactive domain-contai... 111 2e-22 ref|XP_010685228.1| PREDICTED: AT-rich interactive domain-contai... 111 2e-22 ref|XP_002324130.2| arid/bright DNA-binding domain-containing fa... 111 2e-22 ref|XP_007012520.1| ARID/BRIGHT DNA-binding domain-containing pr... 110 3e-22 emb|CDO97800.1| unnamed protein product [Coffea canephora] 110 5e-22 >gb|KDO73757.1| hypothetical protein CISIN_1g004566mg [Citrus sinensis] Length = 614 Score = 119 bits (297), Expect = 1e-24 Identities = 52/52 (100%), Positives = 52/52 (100%) Frame = -3 Query: 426 GICGEWAHFGCDRRQGLGAFKDYAKTDGLEYVCPQCSVTNFKKKSQKTSNGY 271 GICGEWAHFGCDRRQGLGAFKDYAKTDGLEYVCPQCSVTNFKKKSQKTSNGY Sbjct: 563 GICGEWAHFGCDRRQGLGAFKDYAKTDGLEYVCPQCSVTNFKKKSQKTSNGY 614 >ref|XP_006474564.1| PREDICTED: AT-rich interactive domain-containing protein 4-like [Citrus sinensis] gi|641854962|gb|KDO73756.1| hypothetical protein CISIN_1g004566mg [Citrus sinensis] Length = 745 Score = 119 bits (297), Expect = 1e-24 Identities = 52/52 (100%), Positives = 52/52 (100%) Frame = -3 Query: 426 GICGEWAHFGCDRRQGLGAFKDYAKTDGLEYVCPQCSVTNFKKKSQKTSNGY 271 GICGEWAHFGCDRRQGLGAFKDYAKTDGLEYVCPQCSVTNFKKKSQKTSNGY Sbjct: 694 GICGEWAHFGCDRRQGLGAFKDYAKTDGLEYVCPQCSVTNFKKKSQKTSNGY 745 >ref|XP_006452906.1| hypothetical protein CICLE_v10007563mg [Citrus clementina] gi|557556132|gb|ESR66146.1| hypothetical protein CICLE_v10007563mg [Citrus clementina] Length = 745 Score = 119 bits (297), Expect = 1e-24 Identities = 52/52 (100%), Positives = 52/52 (100%) Frame = -3 Query: 426 GICGEWAHFGCDRRQGLGAFKDYAKTDGLEYVCPQCSVTNFKKKSQKTSNGY 271 GICGEWAHFGCDRRQGLGAFKDYAKTDGLEYVCPQCSVTNFKKKSQKTSNGY Sbjct: 694 GICGEWAHFGCDRRQGLGAFKDYAKTDGLEYVCPQCSVTNFKKKSQKTSNGY 745 >ref|XP_002277324.2| PREDICTED: AT-rich interactive domain-containing protein 4 [Vitis vinifera] Length = 740 Score = 113 bits (283), Expect = 5e-23 Identities = 47/52 (90%), Positives = 51/52 (98%) Frame = -3 Query: 426 GICGEWAHFGCDRRQGLGAFKDYAKTDGLEYVCPQCSVTNFKKKSQKTSNGY 271 GICGEWAHFGCDRRQGLGAFKDYAKTDGLEY+CP CS+TNF+KKSQKT+NGY Sbjct: 689 GICGEWAHFGCDRRQGLGAFKDYAKTDGLEYICPHCSITNFQKKSQKTANGY 740 >ref|XP_010047433.1| PREDICTED: AT-rich interactive domain-containing protein 4 [Eucalyptus grandis] gi|629114671|gb|KCW79346.1| hypothetical protein EUGRSUZ_C00764 [Eucalyptus grandis] Length = 746 Score = 113 bits (283), Expect = 5e-23 Identities = 47/52 (90%), Positives = 51/52 (98%) Frame = -3 Query: 426 GICGEWAHFGCDRRQGLGAFKDYAKTDGLEYVCPQCSVTNFKKKSQKTSNGY 271 GICGEWAHFGCDRRQGLGAFKDYAKTDGLEY+CP CS++NFKKKSQKT+NGY Sbjct: 695 GICGEWAHFGCDRRQGLGAFKDYAKTDGLEYICPHCSISNFKKKSQKTANGY 746 >emb|CBI27746.3| unnamed protein product [Vitis vinifera] Length = 739 Score = 113 bits (283), Expect = 5e-23 Identities = 47/52 (90%), Positives = 51/52 (98%) Frame = -3 Query: 426 GICGEWAHFGCDRRQGLGAFKDYAKTDGLEYVCPQCSVTNFKKKSQKTSNGY 271 GICGEWAHFGCDRRQGLGAFKDYAKTDGLEY+CP CS+TNF+KKSQKT+NGY Sbjct: 688 GICGEWAHFGCDRRQGLGAFKDYAKTDGLEYICPHCSITNFQKKSQKTANGY 739 >emb|CAN61485.1| hypothetical protein VITISV_043023 [Vitis vinifera] Length = 106 Score = 113 bits (283), Expect = 5e-23 Identities = 47/52 (90%), Positives = 51/52 (98%) Frame = -3 Query: 426 GICGEWAHFGCDRRQGLGAFKDYAKTDGLEYVCPQCSVTNFKKKSQKTSNGY 271 GICGEWAHFGCDRRQGLGAFKDYAKTDGLEY+CP CS+TNF+KKSQKT+NGY Sbjct: 55 GICGEWAHFGCDRRQGLGAFKDYAKTDGLEYICPHCSITNFQKKSQKTANGY 106 >ref|XP_011039905.1| PREDICTED: AT-rich interactive domain-containing protein 4 isoform X1 [Populus euphratica] Length = 749 Score = 113 bits (282), Expect = 6e-23 Identities = 47/52 (90%), Positives = 50/52 (96%) Frame = -3 Query: 426 GICGEWAHFGCDRRQGLGAFKDYAKTDGLEYVCPQCSVTNFKKKSQKTSNGY 271 GICGEWAHFGCDRRQGLGAFKDYAKTDGLEY+CP CS+ NFKKKSQKT+NGY Sbjct: 698 GICGEWAHFGCDRRQGLGAFKDYAKTDGLEYICPHCSIANFKKKSQKTTNGY 749 >ref|XP_009782074.1| PREDICTED: AT-rich interactive domain-containing protein 4 [Nicotiana sylvestris] Length = 500 Score = 113 bits (282), Expect = 6e-23 Identities = 48/52 (92%), Positives = 50/52 (96%) Frame = -3 Query: 426 GICGEWAHFGCDRRQGLGAFKDYAKTDGLEYVCPQCSVTNFKKKSQKTSNGY 271 GICGEWAHFGCDRR GLGAFKDYAKTDGLEY+CPQCSVTNFKKK QKT+NGY Sbjct: 448 GICGEWAHFGCDRRPGLGAFKDYAKTDGLEYICPQCSVTNFKKKMQKTTNGY 499 >ref|XP_006381551.1| hypothetical protein POPTR_0006s13780g [Populus trichocarpa] gi|550336257|gb|ERP59348.1| hypothetical protein POPTR_0006s13780g [Populus trichocarpa] Length = 749 Score = 113 bits (282), Expect = 6e-23 Identities = 47/52 (90%), Positives = 50/52 (96%) Frame = -3 Query: 426 GICGEWAHFGCDRRQGLGAFKDYAKTDGLEYVCPQCSVTNFKKKSQKTSNGY 271 GICGEWAHFGCDRRQGLGAFKDYAKTDGLEY+CP CS+ NFKKKSQKT+NGY Sbjct: 698 GICGEWAHFGCDRRQGLGAFKDYAKTDGLEYICPNCSIANFKKKSQKTTNGY 749 >ref|XP_012077118.1| PREDICTED: AT-rich interactive domain-containing protein 4 [Jatropha curcas] gi|643724767|gb|KDP33968.1| hypothetical protein JCGZ_07539 [Jatropha curcas] Length = 750 Score = 112 bits (279), Expect = 1e-22 Identities = 46/52 (88%), Positives = 50/52 (96%) Frame = -3 Query: 426 GICGEWAHFGCDRRQGLGAFKDYAKTDGLEYVCPQCSVTNFKKKSQKTSNGY 271 GICGEWAHFGCDRRQGLGAFKDYAKTDGLEY+CP CS+ NF+KKSQKT+NGY Sbjct: 699 GICGEWAHFGCDRRQGLGAFKDYAKTDGLEYICPHCSIANFRKKSQKTANGY 750 >ref|XP_002516200.1| DNA binding protein, putative [Ricinus communis] gi|223544686|gb|EEF46202.1| DNA binding protein, putative [Ricinus communis] Length = 749 Score = 112 bits (279), Expect = 1e-22 Identities = 46/52 (88%), Positives = 50/52 (96%) Frame = -3 Query: 426 GICGEWAHFGCDRRQGLGAFKDYAKTDGLEYVCPQCSVTNFKKKSQKTSNGY 271 GICGEWAHFGCDRRQGLGAFKDYAKTDGLEY+CP CS+ NF+KKSQKT+NGY Sbjct: 698 GICGEWAHFGCDRRQGLGAFKDYAKTDGLEYICPHCSIANFRKKSQKTANGY 749 >ref|XP_004488152.1| PREDICTED: AT-rich interactive domain-containing protein 4 [Cicer arietinum] Length = 755 Score = 112 bits (279), Expect = 1e-22 Identities = 47/52 (90%), Positives = 50/52 (96%) Frame = -3 Query: 426 GICGEWAHFGCDRRQGLGAFKDYAKTDGLEYVCPQCSVTNFKKKSQKTSNGY 271 GICGEWAHFGCDRRQGLGAFKDYAKTDGLEYVCP CS++NF KKSQKT+NGY Sbjct: 704 GICGEWAHFGCDRRQGLGAFKDYAKTDGLEYVCPHCSISNFSKKSQKTANGY 755 >ref|XP_010096547.1| AT-rich interactive domain-containing protein 4 [Morus notabilis] gi|587875558|gb|EXB64667.1| AT-rich interactive domain-containing protein 4 [Morus notabilis] Length = 779 Score = 111 bits (278), Expect = 2e-22 Identities = 47/52 (90%), Positives = 50/52 (96%) Frame = -3 Query: 426 GICGEWAHFGCDRRQGLGAFKDYAKTDGLEYVCPQCSVTNFKKKSQKTSNGY 271 GICGEWAHFGCDRRQGLGAFKDYAKTDGLEY+CP CSV+NFKKKSQK SNG+ Sbjct: 718 GICGEWAHFGCDRRQGLGAFKDYAKTDGLEYICPHCSVSNFKKKSQKVSNGF 769 >ref|XP_009604965.1| PREDICTED: AT-rich interactive domain-containing protein 4 [Nicotiana tomentosiformis] Length = 772 Score = 111 bits (278), Expect = 2e-22 Identities = 47/52 (90%), Positives = 50/52 (96%) Frame = -3 Query: 426 GICGEWAHFGCDRRQGLGAFKDYAKTDGLEYVCPQCSVTNFKKKSQKTSNGY 271 GICGEWAHFGCDRR GLGAFKDYAKTDGLEY+CPQCSVTNFKKK Q+T+NGY Sbjct: 720 GICGEWAHFGCDRRPGLGAFKDYAKTDGLEYICPQCSVTNFKKKVQRTTNGY 771 >ref|XP_011003461.1| PREDICTED: AT-rich interactive domain-containing protein 4-like [Populus euphratica] Length = 746 Score = 111 bits (277), Expect = 2e-22 Identities = 46/52 (88%), Positives = 49/52 (94%) Frame = -3 Query: 426 GICGEWAHFGCDRRQGLGAFKDYAKTDGLEYVCPQCSVTNFKKKSQKTSNGY 271 GICGEWAHFGCDRRQGLGAFKDYAKTDGLEY+CP CS+ NFKKKSQK +NGY Sbjct: 695 GICGEWAHFGCDRRQGLGAFKDYAKTDGLEYICPHCSIANFKKKSQKNANGY 746 >ref|XP_010685228.1| PREDICTED: AT-rich interactive domain-containing protein 4 [Beta vulgaris subsp. vulgaris] gi|870852864|gb|KMT04745.1| hypothetical protein BVRB_7g169250 [Beta vulgaris subsp. vulgaris] Length = 783 Score = 111 bits (277), Expect = 2e-22 Identities = 48/58 (82%), Positives = 52/58 (89%) Frame = -3 Query: 426 GICGEWAHFGCDRRQGLGAFKDYAKTDGLEYVCPQCSVTNFKKKSQKTSNGY*TTPTY 253 GICGEWAHFGCDRRQGLGAFKDYAKTDGLEY+CP CSVTNF+KK QK SNG+ + TY Sbjct: 722 GICGEWAHFGCDRRQGLGAFKDYAKTDGLEYICPHCSVTNFRKKIQKPSNGFSDSLTY 779 >ref|XP_002324130.2| arid/bright DNA-binding domain-containing family protein [Populus trichocarpa] gi|550318261|gb|EEF02695.2| arid/bright DNA-binding domain-containing family protein [Populus trichocarpa] Length = 746 Score = 111 bits (277), Expect = 2e-22 Identities = 46/52 (88%), Positives = 49/52 (94%) Frame = -3 Query: 426 GICGEWAHFGCDRRQGLGAFKDYAKTDGLEYVCPQCSVTNFKKKSQKTSNGY 271 GICGEWAHFGCDRRQGLGAFKDYAKTDGLEY+CP CS+ NFKKKSQK +NGY Sbjct: 695 GICGEWAHFGCDRRQGLGAFKDYAKTDGLEYICPHCSIANFKKKSQKNANGY 746 >ref|XP_007012520.1| ARID/BRIGHT DNA-binding domain-containing protein isoform 1 [Theobroma cacao] gi|590574848|ref|XP_007012521.1| ARID/BRIGHT DNA-binding domain-containing protein isoform 1 [Theobroma cacao] gi|508782883|gb|EOY30139.1| ARID/BRIGHT DNA-binding domain-containing protein isoform 1 [Theobroma cacao] gi|508782884|gb|EOY30140.1| ARID/BRIGHT DNA-binding domain-containing protein isoform 1 [Theobroma cacao] Length = 746 Score = 110 bits (276), Expect = 3e-22 Identities = 47/52 (90%), Positives = 49/52 (94%) Frame = -3 Query: 426 GICGEWAHFGCDRRQGLGAFKDYAKTDGLEYVCPQCSVTNFKKKSQKTSNGY 271 GICGEWAHFGCDRRQGLGAFKDYAKTDGLEYVCP CS++NFKKK QKT NGY Sbjct: 695 GICGEWAHFGCDRRQGLGAFKDYAKTDGLEYVCPHCSISNFKKKPQKTVNGY 746 >emb|CDO97800.1| unnamed protein product [Coffea canephora] Length = 772 Score = 110 bits (274), Expect = 5e-22 Identities = 46/52 (88%), Positives = 49/52 (94%) Frame = -3 Query: 426 GICGEWAHFGCDRRQGLGAFKDYAKTDGLEYVCPQCSVTNFKKKSQKTSNGY 271 G+CGEWAHFGCDRRQGLGAFKDYAKTDGLEY+CPQCSV+ FKKK QKT NGY Sbjct: 721 GVCGEWAHFGCDRRQGLGAFKDYAKTDGLEYICPQCSVSTFKKKMQKTVNGY 772