BLASTX nr result
ID: Zanthoxylum22_contig00024062
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00024062 (600 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008219828.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin... 172 9e-41 ref|XP_007208408.1| hypothetical protein PRUPE_ppa000008mg [Prun... 172 9e-41 gb|KDO59133.1| hypothetical protein CISIN_1g000012mg [Citrus sin... 171 2e-40 gb|KDO59132.1| hypothetical protein CISIN_1g000012mg [Citrus sin... 171 2e-40 ref|XP_006474876.1| PREDICTED: E3 ubiquitin-protein ligase UPL1-... 171 2e-40 ref|XP_006474875.1| PREDICTED: E3 ubiquitin-protein ligase UPL1-... 171 2e-40 ref|XP_006474874.1| PREDICTED: E3 ubiquitin-protein ligase UPL1-... 171 2e-40 ref|XP_006474873.1| PREDICTED: E3 ubiquitin-protein ligase UPL1-... 171 2e-40 ref|XP_006452609.1| hypothetical protein CICLE_v10007219mg [Citr... 171 2e-40 ref|XP_006452608.1| hypothetical protein CICLE_v10007219mg [Citr... 171 2e-40 ref|XP_006452607.1| hypothetical protein CICLE_v10007219mg [Citr... 171 2e-40 ref|XP_006452606.1| hypothetical protein CICLE_v10007219mg [Citr... 171 2e-40 ref|XP_011461879.1| PREDICTED: E3 ubiquitin-protein ligase UPL1 ... 169 8e-40 ref|XP_011461878.1| PREDICTED: E3 ubiquitin-protein ligase UPL1 ... 169 8e-40 ref|XP_009379457.1| PREDICTED: E3 ubiquitin-protein ligase UPL1-... 167 4e-39 ref|XP_009379456.1| PREDICTED: E3 ubiquitin-protein ligase UPL1-... 167 4e-39 ref|XP_009348058.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin... 166 9e-39 ref|XP_008384549.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin... 166 1e-38 ref|XP_012071060.1| PREDICTED: E3 ubiquitin-protein ligase UPL1 ... 165 1e-38 ref|XP_010644588.1| PREDICTED: E3 ubiquitin-protein ligase UPL1 ... 165 1e-38 >ref|XP_008219828.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase UPL1 [Prunus mume] Length = 3730 Score = 172 bits (437), Expect = 9e-41 Identities = 78/84 (92%), Positives = 82/84 (97%) Frame = -3 Query: 253 MKLKRRRAVEVPPKIRSFINSVTAVPLENIEAPLKNFIWEFDKGDFHHWVDLFNHFDSFF 74 MKLKRRRAVEVPPKIRSFINSVTAVPLENIE PLK F+WEFDKGDFHHWVDLFNHFDSFF Sbjct: 1 MKLKRRRAVEVPPKIRSFINSVTAVPLENIEGPLKGFVWEFDKGDFHHWVDLFNHFDSFF 60 Query: 73 DKHLKSRKDLQVEDNFLESDPPFP 2 +KH+KSRKDLQVEDNFL+SDPPFP Sbjct: 61 EKHIKSRKDLQVEDNFLDSDPPFP 84 >ref|XP_007208408.1| hypothetical protein PRUPE_ppa000008mg [Prunus persica] gi|462404050|gb|EMJ09607.1| hypothetical protein PRUPE_ppa000008mg [Prunus persica] Length = 3766 Score = 172 bits (437), Expect = 9e-41 Identities = 78/84 (92%), Positives = 82/84 (97%) Frame = -3 Query: 253 MKLKRRRAVEVPPKIRSFINSVTAVPLENIEAPLKNFIWEFDKGDFHHWVDLFNHFDSFF 74 MKLKRRRAVEVPPKIRSFINSVTAVPLENIE PLK F+WEFDKGDFHHWVDLFNHFDSFF Sbjct: 1 MKLKRRRAVEVPPKIRSFINSVTAVPLENIEGPLKGFVWEFDKGDFHHWVDLFNHFDSFF 60 Query: 73 DKHLKSRKDLQVEDNFLESDPPFP 2 +KH+KSRKDLQVEDNFL+SDPPFP Sbjct: 61 EKHIKSRKDLQVEDNFLDSDPPFP 84 >gb|KDO59133.1| hypothetical protein CISIN_1g000012mg [Citrus sinensis] Length = 3775 Score = 171 bits (434), Expect = 2e-40 Identities = 77/84 (91%), Positives = 82/84 (97%) Frame = -3 Query: 253 MKLKRRRAVEVPPKIRSFINSVTAVPLENIEAPLKNFIWEFDKGDFHHWVDLFNHFDSFF 74 MKLKRRRA+EVPPKIRS INS+TAVPLENI+ PLKNF+WEFDKGDFHHWVDLFNHFDSFF Sbjct: 1 MKLKRRRALEVPPKIRSVINSITAVPLENIDEPLKNFLWEFDKGDFHHWVDLFNHFDSFF 60 Query: 73 DKHLKSRKDLQVEDNFLESDPPFP 2 DKH+KSRKDLQVEDNFLESDPPFP Sbjct: 61 DKHIKSRKDLQVEDNFLESDPPFP 84 >gb|KDO59132.1| hypothetical protein CISIN_1g000012mg [Citrus sinensis] Length = 3776 Score = 171 bits (434), Expect = 2e-40 Identities = 77/84 (91%), Positives = 82/84 (97%) Frame = -3 Query: 253 MKLKRRRAVEVPPKIRSFINSVTAVPLENIEAPLKNFIWEFDKGDFHHWVDLFNHFDSFF 74 MKLKRRRA+EVPPKIRS INS+TAVPLENI+ PLKNF+WEFDKGDFHHWVDLFNHFDSFF Sbjct: 1 MKLKRRRALEVPPKIRSVINSITAVPLENIDEPLKNFLWEFDKGDFHHWVDLFNHFDSFF 60 Query: 73 DKHLKSRKDLQVEDNFLESDPPFP 2 DKH+KSRKDLQVEDNFLESDPPFP Sbjct: 61 DKHIKSRKDLQVEDNFLESDPPFP 84 >ref|XP_006474876.1| PREDICTED: E3 ubiquitin-protein ligase UPL1-like isoform X4 [Citrus sinensis] Length = 3740 Score = 171 bits (434), Expect = 2e-40 Identities = 77/84 (91%), Positives = 82/84 (97%) Frame = -3 Query: 253 MKLKRRRAVEVPPKIRSFINSVTAVPLENIEAPLKNFIWEFDKGDFHHWVDLFNHFDSFF 74 MKLKRRRA+EVPPKIRS INS+TAVPLENI+ PLKNF+WEFDKGDFHHWVDLFNHFDSFF Sbjct: 1 MKLKRRRALEVPPKIRSVINSITAVPLENIDEPLKNFLWEFDKGDFHHWVDLFNHFDSFF 60 Query: 73 DKHLKSRKDLQVEDNFLESDPPFP 2 DKH+KSRKDLQVEDNFLESDPPFP Sbjct: 61 DKHIKSRKDLQVEDNFLESDPPFP 84 >ref|XP_006474875.1| PREDICTED: E3 ubiquitin-protein ligase UPL1-like isoform X3 [Citrus sinensis] Length = 3741 Score = 171 bits (434), Expect = 2e-40 Identities = 77/84 (91%), Positives = 82/84 (97%) Frame = -3 Query: 253 MKLKRRRAVEVPPKIRSFINSVTAVPLENIEAPLKNFIWEFDKGDFHHWVDLFNHFDSFF 74 MKLKRRRA+EVPPKIRS INS+TAVPLENI+ PLKNF+WEFDKGDFHHWVDLFNHFDSFF Sbjct: 1 MKLKRRRALEVPPKIRSVINSITAVPLENIDEPLKNFLWEFDKGDFHHWVDLFNHFDSFF 60 Query: 73 DKHLKSRKDLQVEDNFLESDPPFP 2 DKH+KSRKDLQVEDNFLESDPPFP Sbjct: 61 DKHIKSRKDLQVEDNFLESDPPFP 84 >ref|XP_006474874.1| PREDICTED: E3 ubiquitin-protein ligase UPL1-like isoform X2 [Citrus sinensis] Length = 3775 Score = 171 bits (434), Expect = 2e-40 Identities = 77/84 (91%), Positives = 82/84 (97%) Frame = -3 Query: 253 MKLKRRRAVEVPPKIRSFINSVTAVPLENIEAPLKNFIWEFDKGDFHHWVDLFNHFDSFF 74 MKLKRRRA+EVPPKIRS INS+TAVPLENI+ PLKNF+WEFDKGDFHHWVDLFNHFDSFF Sbjct: 1 MKLKRRRALEVPPKIRSVINSITAVPLENIDEPLKNFLWEFDKGDFHHWVDLFNHFDSFF 60 Query: 73 DKHLKSRKDLQVEDNFLESDPPFP 2 DKH+KSRKDLQVEDNFLESDPPFP Sbjct: 61 DKHIKSRKDLQVEDNFLESDPPFP 84 >ref|XP_006474873.1| PREDICTED: E3 ubiquitin-protein ligase UPL1-like isoform X1 [Citrus sinensis] Length = 3776 Score = 171 bits (434), Expect = 2e-40 Identities = 77/84 (91%), Positives = 82/84 (97%) Frame = -3 Query: 253 MKLKRRRAVEVPPKIRSFINSVTAVPLENIEAPLKNFIWEFDKGDFHHWVDLFNHFDSFF 74 MKLKRRRA+EVPPKIRS INS+TAVPLENI+ PLKNF+WEFDKGDFHHWVDLFNHFDSFF Sbjct: 1 MKLKRRRALEVPPKIRSVINSITAVPLENIDEPLKNFLWEFDKGDFHHWVDLFNHFDSFF 60 Query: 73 DKHLKSRKDLQVEDNFLESDPPFP 2 DKH+KSRKDLQVEDNFLESDPPFP Sbjct: 61 DKHIKSRKDLQVEDNFLESDPPFP 84 >ref|XP_006452609.1| hypothetical protein CICLE_v10007219mg [Citrus clementina] gi|557555835|gb|ESR65849.1| hypothetical protein CICLE_v10007219mg [Citrus clementina] Length = 3704 Score = 171 bits (434), Expect = 2e-40 Identities = 77/84 (91%), Positives = 82/84 (97%) Frame = -3 Query: 253 MKLKRRRAVEVPPKIRSFINSVTAVPLENIEAPLKNFIWEFDKGDFHHWVDLFNHFDSFF 74 MKLKRRRA+EVPPKIRS INS+TAVPLENI+ PLKNF+WEFDKGDFHHWVDLFNHFDSFF Sbjct: 1 MKLKRRRALEVPPKIRSVINSITAVPLENIDEPLKNFLWEFDKGDFHHWVDLFNHFDSFF 60 Query: 73 DKHLKSRKDLQVEDNFLESDPPFP 2 DKH+KSRKDLQVEDNFLESDPPFP Sbjct: 61 DKHIKSRKDLQVEDNFLESDPPFP 84 >ref|XP_006452608.1| hypothetical protein CICLE_v10007219mg [Citrus clementina] gi|557555834|gb|ESR65848.1| hypothetical protein CICLE_v10007219mg [Citrus clementina] Length = 3775 Score = 171 bits (434), Expect = 2e-40 Identities = 77/84 (91%), Positives = 82/84 (97%) Frame = -3 Query: 253 MKLKRRRAVEVPPKIRSFINSVTAVPLENIEAPLKNFIWEFDKGDFHHWVDLFNHFDSFF 74 MKLKRRRA+EVPPKIRS INS+TAVPLENI+ PLKNF+WEFDKGDFHHWVDLFNHFDSFF Sbjct: 1 MKLKRRRALEVPPKIRSVINSITAVPLENIDEPLKNFLWEFDKGDFHHWVDLFNHFDSFF 60 Query: 73 DKHLKSRKDLQVEDNFLESDPPFP 2 DKH+KSRKDLQVEDNFLESDPPFP Sbjct: 61 DKHIKSRKDLQVEDNFLESDPPFP 84 >ref|XP_006452607.1| hypothetical protein CICLE_v10007219mg [Citrus clementina] gi|557555833|gb|ESR65847.1| hypothetical protein CICLE_v10007219mg [Citrus clementina] Length = 3740 Score = 171 bits (434), Expect = 2e-40 Identities = 77/84 (91%), Positives = 82/84 (97%) Frame = -3 Query: 253 MKLKRRRAVEVPPKIRSFINSVTAVPLENIEAPLKNFIWEFDKGDFHHWVDLFNHFDSFF 74 MKLKRRRA+EVPPKIRS INS+TAVPLENI+ PLKNF+WEFDKGDFHHWVDLFNHFDSFF Sbjct: 1 MKLKRRRALEVPPKIRSVINSITAVPLENIDEPLKNFLWEFDKGDFHHWVDLFNHFDSFF 60 Query: 73 DKHLKSRKDLQVEDNFLESDPPFP 2 DKH+KSRKDLQVEDNFLESDPPFP Sbjct: 61 DKHIKSRKDLQVEDNFLESDPPFP 84 >ref|XP_006452606.1| hypothetical protein CICLE_v10007219mg [Citrus clementina] gi|557555832|gb|ESR65846.1| hypothetical protein CICLE_v10007219mg [Citrus clementina] Length = 3739 Score = 171 bits (434), Expect = 2e-40 Identities = 77/84 (91%), Positives = 82/84 (97%) Frame = -3 Query: 253 MKLKRRRAVEVPPKIRSFINSVTAVPLENIEAPLKNFIWEFDKGDFHHWVDLFNHFDSFF 74 MKLKRRRA+EVPPKIRS INS+TAVPLENI+ PLKNF+WEFDKGDFHHWVDLFNHFDSFF Sbjct: 1 MKLKRRRALEVPPKIRSVINSITAVPLENIDEPLKNFLWEFDKGDFHHWVDLFNHFDSFF 60 Query: 73 DKHLKSRKDLQVEDNFLESDPPFP 2 DKH+KSRKDLQVEDNFLESDPPFP Sbjct: 61 DKHIKSRKDLQVEDNFLESDPPFP 84 >ref|XP_011461879.1| PREDICTED: E3 ubiquitin-protein ligase UPL1 isoform X2 [Fragaria vesca subsp. vesca] Length = 3767 Score = 169 bits (429), Expect = 8e-40 Identities = 76/84 (90%), Positives = 81/84 (96%) Frame = -3 Query: 253 MKLKRRRAVEVPPKIRSFINSVTAVPLENIEAPLKNFIWEFDKGDFHHWVDLFNHFDSFF 74 MKLKRRRAVEVPPKIRSFINSVTAVP ENIE PLK F+WE+DKGDFHHWVDLFNHFDSFF Sbjct: 1 MKLKRRRAVEVPPKIRSFINSVTAVPFENIEEPLKGFVWEYDKGDFHHWVDLFNHFDSFF 60 Query: 73 DKHLKSRKDLQVEDNFLESDPPFP 2 +KH+KSRKDLQVEDNFL+SDPPFP Sbjct: 61 EKHIKSRKDLQVEDNFLDSDPPFP 84 >ref|XP_011461878.1| PREDICTED: E3 ubiquitin-protein ligase UPL1 isoform X1 [Fragaria vesca subsp. vesca] Length = 3768 Score = 169 bits (429), Expect = 8e-40 Identities = 76/84 (90%), Positives = 81/84 (96%) Frame = -3 Query: 253 MKLKRRRAVEVPPKIRSFINSVTAVPLENIEAPLKNFIWEFDKGDFHHWVDLFNHFDSFF 74 MKLKRRRAVEVPPKIRSFINSVTAVP ENIE PLK F+WE+DKGDFHHWVDLFNHFDSFF Sbjct: 1 MKLKRRRAVEVPPKIRSFINSVTAVPFENIEEPLKGFVWEYDKGDFHHWVDLFNHFDSFF 60 Query: 73 DKHLKSRKDLQVEDNFLESDPPFP 2 +KH+KSRKDLQVEDNFL+SDPPFP Sbjct: 61 EKHIKSRKDLQVEDNFLDSDPPFP 84 >ref|XP_009379457.1| PREDICTED: E3 ubiquitin-protein ligase UPL1-like isoform X2 [Pyrus x bretschneideri] Length = 3786 Score = 167 bits (423), Expect = 4e-39 Identities = 76/84 (90%), Positives = 80/84 (95%) Frame = -3 Query: 253 MKLKRRRAVEVPPKIRSFINSVTAVPLENIEAPLKNFIWEFDKGDFHHWVDLFNHFDSFF 74 MKLKRRRAVEVPPKIRSFIN VTAVP ENIE PLK FIWEFDKGDFHHWVDLFNHFDSFF Sbjct: 1 MKLKRRRAVEVPPKIRSFINRVTAVPSENIEEPLKGFIWEFDKGDFHHWVDLFNHFDSFF 60 Query: 73 DKHLKSRKDLQVEDNFLESDPPFP 2 +KH+KSRKDLQV+DNFLE+DPPFP Sbjct: 61 EKHIKSRKDLQVDDNFLETDPPFP 84 >ref|XP_009379456.1| PREDICTED: E3 ubiquitin-protein ligase UPL1-like isoform X1 [Pyrus x bretschneideri] Length = 3787 Score = 167 bits (423), Expect = 4e-39 Identities = 76/84 (90%), Positives = 80/84 (95%) Frame = -3 Query: 253 MKLKRRRAVEVPPKIRSFINSVTAVPLENIEAPLKNFIWEFDKGDFHHWVDLFNHFDSFF 74 MKLKRRRAVEVPPKIRSFIN VTAVP ENIE PLK FIWEFDKGDFHHWVDLFNHFDSFF Sbjct: 1 MKLKRRRAVEVPPKIRSFINRVTAVPSENIEEPLKGFIWEFDKGDFHHWVDLFNHFDSFF 60 Query: 73 DKHLKSRKDLQVEDNFLESDPPFP 2 +KH+KSRKDLQV+DNFLE+DPPFP Sbjct: 61 EKHIKSRKDLQVDDNFLETDPPFP 84 >ref|XP_009348058.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase UPL1-like [Pyrus x bretschneideri] Length = 3763 Score = 166 bits (420), Expect = 9e-39 Identities = 76/84 (90%), Positives = 80/84 (95%) Frame = -3 Query: 253 MKLKRRRAVEVPPKIRSFINSVTAVPLENIEAPLKNFIWEFDKGDFHHWVDLFNHFDSFF 74 MKLKRRRAVEVPPKIRSFINSVTAVP E IE PLK FIWEFDKGDFHHWVDLFNHFDSFF Sbjct: 1 MKLKRRRAVEVPPKIRSFINSVTAVPFEIIEEPLKGFIWEFDKGDFHHWVDLFNHFDSFF 60 Query: 73 DKHLKSRKDLQVEDNFLESDPPFP 2 +KH+KSRKDLQ++DNFLESDPPFP Sbjct: 61 EKHVKSRKDLQLDDNFLESDPPFP 84 >ref|XP_008384549.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase UPL1-like [Malus domestica] Length = 3787 Score = 166 bits (419), Expect = 1e-38 Identities = 75/84 (89%), Positives = 80/84 (95%) Frame = -3 Query: 253 MKLKRRRAVEVPPKIRSFINSVTAVPLENIEAPLKNFIWEFDKGDFHHWVDLFNHFDSFF 74 MKLKRRRAVEVPPKIRSFINSVTAV ENIE PLK FIWEFDKGDFHHWVDLFNHFDSFF Sbjct: 1 MKLKRRRAVEVPPKIRSFINSVTAVXFENIEEPLKGFIWEFDKGDFHHWVDLFNHFDSFF 60 Query: 73 DKHLKSRKDLQVEDNFLESDPPFP 2 +KH+KSRKDLQV+DNFL++DPPFP Sbjct: 61 EKHIKSRKDLQVDDNFLDTDPPFP 84 >ref|XP_012071060.1| PREDICTED: E3 ubiquitin-protein ligase UPL1 isoform X1 [Jatropha curcas] gi|802588758|ref|XP_012071061.1| PREDICTED: E3 ubiquitin-protein ligase UPL1 isoform X2 [Jatropha curcas] Length = 3762 Score = 165 bits (418), Expect = 1e-38 Identities = 72/84 (85%), Positives = 81/84 (96%) Frame = -3 Query: 253 MKLKRRRAVEVPPKIRSFINSVTAVPLENIEAPLKNFIWEFDKGDFHHWVDLFNHFDSFF 74 MKLKRRR++EVPPKI+SFIN+VT +PLENIE PLK+F+WEFDKGDFHHWVDLFNHFDSFF Sbjct: 1 MKLKRRRSLEVPPKIKSFINTVTTIPLENIEEPLKSFVWEFDKGDFHHWVDLFNHFDSFF 60 Query: 73 DKHLKSRKDLQVEDNFLESDPPFP 2 +KH+K RKDLQVEDNFLESDPPFP Sbjct: 61 EKHIKPRKDLQVEDNFLESDPPFP 84 >ref|XP_010644588.1| PREDICTED: E3 ubiquitin-protein ligase UPL1 isoform X2 [Vitis vinifera] Length = 3782 Score = 165 bits (418), Expect = 1e-38 Identities = 75/84 (89%), Positives = 79/84 (94%) Frame = -3 Query: 253 MKLKRRRAVEVPPKIRSFINSVTAVPLENIEAPLKNFIWEFDKGDFHHWVDLFNHFDSFF 74 MKLKRRRA+EVPPKIRSFIN VT+ PLENIE PLK FIWEFDKGDFHHWVDLFNHFDSFF Sbjct: 1 MKLKRRRALEVPPKIRSFINGVTSTPLENIEEPLKCFIWEFDKGDFHHWVDLFNHFDSFF 60 Query: 73 DKHLKSRKDLQVEDNFLESDPPFP 2 +KH+K RKDLQVEDNFLESDPPFP Sbjct: 61 EKHIKPRKDLQVEDNFLESDPPFP 84