BLASTX nr result
ID: Zanthoxylum22_contig00023899
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00023899 (385 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO52217.1| hypothetical protein CISIN_1g009109mg [Citrus sin... 60 6e-07 ref|XP_006432085.1| hypothetical protein CICLE_v10000776mg [Citr... 60 6e-07 >gb|KDO52217.1| hypothetical protein CISIN_1g009109mg [Citrus sinensis] gi|641833200|gb|KDO52218.1| hypothetical protein CISIN_1g009109mg [Citrus sinensis] gi|641833201|gb|KDO52219.1| hypothetical protein CISIN_1g009109mg [Citrus sinensis] gi|641833202|gb|KDO52220.1| hypothetical protein CISIN_1g009109mg [Citrus sinensis] Length = 429 Score = 60.1 bits (144), Expect = 6e-07 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = -2 Query: 384 LDVPEDSMVMNEEIFGPLLPIVTVSILSSIHLKPNAC 274 LDVP+DS +M EEIFGPLLPIVTVSI+SS H K AC Sbjct: 392 LDVPDDSTIMKEEIFGPLLPIVTVSIVSSAHFKLKAC 428 >ref|XP_006432085.1| hypothetical protein CICLE_v10000776mg [Citrus clementina] gi|567879057|ref|XP_006432087.1| hypothetical protein CICLE_v10000776mg [Citrus clementina] gi|568820879|ref|XP_006464931.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like isoform X2 [Citrus sinensis] gi|557534207|gb|ESR45325.1| hypothetical protein CICLE_v10000776mg [Citrus clementina] gi|557534209|gb|ESR45327.1| hypothetical protein CICLE_v10000776mg [Citrus clementina] Length = 429 Score = 60.1 bits (144), Expect = 6e-07 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = -2 Query: 384 LDVPEDSMVMNEEIFGPLLPIVTVSILSSIHLKPNAC 274 LDVP+DS +M EEIFGPLLPIVTVSI+SS H K AC Sbjct: 392 LDVPDDSTIMKEEIFGPLLPIVTVSIVSSAHFKLKAC 428