BLASTX nr result
ID: Zanthoxylum22_contig00023762
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00023762 (366 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006448276.1| hypothetical protein CICLE_v10017051mg [Citr... 61 3e-07 ref|XP_006469164.1| PREDICTED: extensin-like [Citrus sinensis] 59 2e-06 >ref|XP_006448276.1| hypothetical protein CICLE_v10017051mg [Citrus clementina] gi|557550887|gb|ESR61516.1| hypothetical protein CICLE_v10017051mg [Citrus clementina] Length = 155 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = -1 Query: 225 RKPPHKTDDQSSARTLGKSTVLVTAANALVFLFLVTSCS 109 RKPPH+TD+QSSA + GKS L+TAAN LVF+FL TSCS Sbjct: 117 RKPPHQTDNQSSATSTGKSMALITAANVLVFVFLFTSCS 155 >ref|XP_006469164.1| PREDICTED: extensin-like [Citrus sinensis] Length = 155 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = -1 Query: 225 RKPPHKTDDQSSARTLGKSTVLVTAANALVFLFLVTSC 112 RKPPH+TD+QSSA + GKS L+TAAN LVF+F+ TSC Sbjct: 117 RKPPHQTDNQSSATSTGKSMALITAANVLVFVFVFTSC 154