BLASTX nr result
ID: Zanthoxylum22_contig00023754
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00023754 (304 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006479892.1| PREDICTED: peptide chain release factor 1-li... 78 2e-12 ref|XP_006444254.1| hypothetical protein CICLE_v10023263mg [Citr... 74 3e-11 >ref|XP_006479892.1| PREDICTED: peptide chain release factor 1-like, mitochondrial-like [Citrus sinensis] Length = 416 Score = 78.2 bits (191), Expect = 2e-12 Identities = 39/54 (72%), Positives = 45/54 (83%) Frame = +1 Query: 121 MNSLTMLSTARLHASLNHFPQRRRFGGSHSRKNFVVVVNPSPSFRTSKIICMAE 282 MNSLTMLSTAR++ LNH PQR+RFGGS S++N VV PSPSFRT K+ICMAE Sbjct: 1 MNSLTMLSTARIYTPLNHSPQRQRFGGSQSKRN---VVFPSPSFRTPKLICMAE 51 >ref|XP_006444254.1| hypothetical protein CICLE_v10023263mg [Citrus clementina] gi|557546516|gb|ESR57494.1| hypothetical protein CICLE_v10023263mg [Citrus clementina] gi|641868681|gb|KDO87365.1| hypothetical protein CISIN_1g014874mg [Citrus sinensis] Length = 416 Score = 74.3 bits (181), Expect = 3e-11 Identities = 38/54 (70%), Positives = 44/54 (81%) Frame = +1 Query: 121 MNSLTMLSTARLHASLNHFPQRRRFGGSHSRKNFVVVVNPSPSFRTSKIICMAE 282 MNSLTMLSTAR++ LNH PQR+RFGGS S++N VV PS SFRT K+ICMAE Sbjct: 1 MNSLTMLSTARIYTPLNHSPQRQRFGGSQSKRN---VVFPSLSFRTPKLICMAE 51