BLASTX nr result
ID: Zanthoxylum22_contig00023539
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00023539 (370 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO75773.1| hypothetical protein CISIN_1g020642mg [Citrus sin... 87 4e-15 ref|XP_006467880.1| PREDICTED: transmembrane protein 184C-like [... 87 4e-15 ref|XP_006449236.1| hypothetical protein CICLE_v10016111mg [Citr... 87 4e-15 ref|XP_011461975.1| PREDICTED: transmembrane protein 184 homolog... 75 3e-11 ref|XP_008224968.1| PREDICTED: transmembrane protein 184C [Prunu... 75 3e-11 ref|XP_007211718.1| hypothetical protein PRUPE_ppa009378mg [Prun... 75 3e-11 emb|CAN61223.1| hypothetical protein VITISV_038806 [Vitis vinifera] 73 1e-10 ref|XP_007025760.1| Uncharacterized protein isoform 2 [Theobroma... 72 2e-10 ref|XP_007025759.1| Uncharacterized protein isoform 1 [Theobroma... 72 2e-10 emb|CBI23472.3| unnamed protein product [Vitis vinifera] 71 3e-10 ref|XP_002268954.2| PREDICTED: transmembrane protein 184 homolog... 71 3e-10 ref|XP_010268813.1| PREDICTED: transmembrane protein 184C-like [... 71 4e-10 ref|XP_011096233.1| PREDICTED: transmembrane protein 184C-like [... 70 8e-10 ref|XP_002521429.1| conserved hypothetical protein [Ricinus comm... 70 8e-10 ref|XP_010278359.1| PREDICTED: transmembrane protein 184C-like [... 69 1e-09 ref|XP_012091517.1| PREDICTED: transmembrane protein 184C-like [... 69 1e-09 ref|XP_012443313.1| PREDICTED: transmembrane protein 184C-like [... 69 1e-09 gb|KDP20899.1| hypothetical protein JCGZ_21370 [Jatropha curcas] 69 1e-09 ref|XP_004485717.1| PREDICTED: transmembrane protein 184A [Cicer... 69 1e-09 ref|XP_010057489.1| PREDICTED: transmembrane protein 184C-like [... 68 3e-09 >gb|KDO75773.1| hypothetical protein CISIN_1g020642mg [Citrus sinensis] Length = 323 Score = 87.4 bits (215), Expect = 4e-15 Identities = 41/44 (93%), Positives = 44/44 (100%) Frame = +2 Query: 2 NEAIQNVLVCLEMVVFSVLQKYAYPATPYSGDVEAKLKLNKKTE 133 NEAIQNVLVCLEMVVFS++Q+YAYPATPYSGDVEAKLKLNKKTE Sbjct: 280 NEAIQNVLVCLEMVVFSIIQQYAYPATPYSGDVEAKLKLNKKTE 323 >ref|XP_006467880.1| PREDICTED: transmembrane protein 184C-like [Citrus sinensis] gi|641857006|gb|KDO75772.1| hypothetical protein CISIN_1g020642mg [Citrus sinensis] Length = 295 Score = 87.4 bits (215), Expect = 4e-15 Identities = 41/44 (93%), Positives = 44/44 (100%) Frame = +2 Query: 2 NEAIQNVLVCLEMVVFSVLQKYAYPATPYSGDVEAKLKLNKKTE 133 NEAIQNVLVCLEMVVFS++Q+YAYPATPYSGDVEAKLKLNKKTE Sbjct: 252 NEAIQNVLVCLEMVVFSIIQQYAYPATPYSGDVEAKLKLNKKTE 295 >ref|XP_006449236.1| hypothetical protein CICLE_v10016111mg [Citrus clementina] gi|557551847|gb|ESR62476.1| hypothetical protein CICLE_v10016111mg [Citrus clementina] Length = 295 Score = 87.4 bits (215), Expect = 4e-15 Identities = 41/44 (93%), Positives = 44/44 (100%) Frame = +2 Query: 2 NEAIQNVLVCLEMVVFSVLQKYAYPATPYSGDVEAKLKLNKKTE 133 NEAIQNVLVCLEMVVFS++Q+YAYPATPYSGDVEAKLKLNKKTE Sbjct: 252 NEAIQNVLVCLEMVVFSIIQQYAYPATPYSGDVEAKLKLNKKTE 295 >ref|XP_011461975.1| PREDICTED: transmembrane protein 184 homolog DDB_G0279555-like [Fragaria vesca subsp. vesca] Length = 129 Score = 74.7 bits (182), Expect = 3e-11 Identities = 34/44 (77%), Positives = 39/44 (88%) Frame = +2 Query: 2 NEAIQNVLVCLEMVVFSVLQKYAYPATPYSGDVEAKLKLNKKTE 133 NEAIQNVL+CLEMVVFSVLQ+YAY PYSGDVE K+++NKK E Sbjct: 86 NEAIQNVLICLEMVVFSVLQQYAYHVAPYSGDVETKMRVNKKNE 129 >ref|XP_008224968.1| PREDICTED: transmembrane protein 184C [Prunus mume] Length = 295 Score = 74.7 bits (182), Expect = 3e-11 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = +2 Query: 5 EAIQNVLVCLEMVVFSVLQKYAYPATPYSGDVEAKLKLNKKTE 133 EAIQNVL+CLEMVVFSVLQ+YAY PYSGDVE+K+KLNKK E Sbjct: 253 EAIQNVLICLEMVVFSVLQQYAYHVAPYSGDVESKMKLNKKRE 295 >ref|XP_007211718.1| hypothetical protein PRUPE_ppa009378mg [Prunus persica] gi|462407583|gb|EMJ12917.1| hypothetical protein PRUPE_ppa009378mg [Prunus persica] Length = 295 Score = 74.7 bits (182), Expect = 3e-11 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = +2 Query: 5 EAIQNVLVCLEMVVFSVLQKYAYPATPYSGDVEAKLKLNKKTE 133 EAIQNVL+CLEMVVFSVLQ+YAY PYSGDVE+K+KLNKK E Sbjct: 253 EAIQNVLICLEMVVFSVLQQYAYHVAPYSGDVESKMKLNKKRE 295 >emb|CAN61223.1| hypothetical protein VITISV_038806 [Vitis vinifera] Length = 295 Score = 72.8 bits (177), Expect = 1e-10 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = +2 Query: 5 EAIQNVLVCLEMVVFSVLQKYAYPATPYSGDVEAKLKLNKKTE 133 EAIQNVLVC+EMVVFSVLQ+YAY PYSGD+EAKLKL+KK E Sbjct: 253 EAIQNVLVCVEMVVFSVLQQYAYHVAPYSGDMEAKLKLSKKRE 295 >ref|XP_007025760.1| Uncharacterized protein isoform 2 [Theobroma cacao] gi|508781126|gb|EOY28382.1| Uncharacterized protein isoform 2 [Theobroma cacao] Length = 258 Score = 72.0 bits (175), Expect = 2e-10 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = +2 Query: 5 EAIQNVLVCLEMVVFSVLQKYAYPATPYSGDVEAKLKLNKKTE 133 EA+QNVLVCLEMVVFSVLQ+YAY PYSG+VEAK+KL KK E Sbjct: 216 EALQNVLVCLEMVVFSVLQQYAYHVAPYSGEVEAKMKLGKKNE 258 >ref|XP_007025759.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|590624999|ref|XP_007025761.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|508781125|gb|EOY28381.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|508781127|gb|EOY28383.1| Uncharacterized protein isoform 1 [Theobroma cacao] Length = 295 Score = 72.0 bits (175), Expect = 2e-10 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = +2 Query: 5 EAIQNVLVCLEMVVFSVLQKYAYPATPYSGDVEAKLKLNKKTE 133 EA+QNVLVCLEMVVFSVLQ+YAY PYSG+VEAK+KL KK E Sbjct: 253 EALQNVLVCLEMVVFSVLQQYAYHVAPYSGEVEAKMKLGKKNE 295 >emb|CBI23472.3| unnamed protein product [Vitis vinifera] Length = 220 Score = 71.2 bits (173), Expect = 3e-10 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = +2 Query: 5 EAIQNVLVCLEMVVFSVLQKYAYPATPYSGDVEAKLKLNKKTE 133 EAIQNVLVC+EMVVFSVLQ+YA+ PYSGD+EAKLKL+KK E Sbjct: 178 EAIQNVLVCVEMVVFSVLQQYAFHVAPYSGDMEAKLKLSKKRE 220 >ref|XP_002268954.2| PREDICTED: transmembrane protein 184 homolog DDB_G0279555-like [Vitis vinifera] Length = 295 Score = 71.2 bits (173), Expect = 3e-10 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = +2 Query: 5 EAIQNVLVCLEMVVFSVLQKYAYPATPYSGDVEAKLKLNKKTE 133 EAIQNVLVC+EMVVFSVLQ+YA+ PYSGD+EAKLKL+KK E Sbjct: 253 EAIQNVLVCVEMVVFSVLQQYAFHVAPYSGDMEAKLKLSKKRE 295 >ref|XP_010268813.1| PREDICTED: transmembrane protein 184C-like [Nelumbo nucifera] Length = 295 Score = 70.9 bits (172), Expect = 4e-10 Identities = 32/43 (74%), Positives = 38/43 (88%) Frame = +2 Query: 5 EAIQNVLVCLEMVVFSVLQKYAYPATPYSGDVEAKLKLNKKTE 133 EA+QNV+VCLEMVVFSVLQ+YAYP TPYSGD+ +KL +KK E Sbjct: 253 EALQNVMVCLEMVVFSVLQQYAYPVTPYSGDIASKLTSDKKNE 295 >ref|XP_011096233.1| PREDICTED: transmembrane protein 184C-like [Sesamum indicum] Length = 295 Score = 69.7 bits (169), Expect = 8e-10 Identities = 31/43 (72%), Positives = 38/43 (88%) Frame = +2 Query: 5 EAIQNVLVCLEMVVFSVLQKYAYPATPYSGDVEAKLKLNKKTE 133 EAIQNVLVC+EMV+FSV+Q+YAY PYSGD+E+KLK+ KK E Sbjct: 253 EAIQNVLVCVEMVIFSVIQQYAYHVAPYSGDIESKLKMQKKYE 295 >ref|XP_002521429.1| conserved hypothetical protein [Ricinus communis] gi|223539328|gb|EEF40919.1| conserved hypothetical protein [Ricinus communis] Length = 294 Score = 69.7 bits (169), Expect = 8e-10 Identities = 32/40 (80%), Positives = 36/40 (90%) Frame = +2 Query: 5 EAIQNVLVCLEMVVFSVLQKYAYPATPYSGDVEAKLKLNK 124 EA+QNVLVCLEMVVFSVLQ+YAY PYSGD+E K+KLNK Sbjct: 253 EALQNVLVCLEMVVFSVLQQYAYHVAPYSGDIERKMKLNK 292 >ref|XP_010278359.1| PREDICTED: transmembrane protein 184C-like [Nelumbo nucifera] gi|720072410|ref|XP_010278360.1| PREDICTED: transmembrane protein 184C-like [Nelumbo nucifera] gi|720072413|ref|XP_010278362.1| PREDICTED: transmembrane protein 184C-like [Nelumbo nucifera] gi|720072416|ref|XP_010278363.1| PREDICTED: transmembrane protein 184C-like [Nelumbo nucifera] gi|720072419|ref|XP_010278364.1| PREDICTED: transmembrane protein 184C-like [Nelumbo nucifera] Length = 295 Score = 69.3 bits (168), Expect = 1e-09 Identities = 31/43 (72%), Positives = 37/43 (86%) Frame = +2 Query: 5 EAIQNVLVCLEMVVFSVLQKYAYPATPYSGDVEAKLKLNKKTE 133 EA+QNVLVCLEM++FSV Q+YAYP TPYSGDV +KL +KK E Sbjct: 253 EALQNVLVCLEMIIFSVFQQYAYPVTPYSGDVASKLLSDKKNE 295 >ref|XP_012091517.1| PREDICTED: transmembrane protein 184C-like [Jatropha curcas] Length = 294 Score = 68.9 bits (167), Expect = 1e-09 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = +2 Query: 5 EAIQNVLVCLEMVVFSVLQKYAYPATPYSGDVEAKLKLNKK 127 EA+QNVLVCLEMVVFSVLQ+YAY PYSGD EAK++L KK Sbjct: 253 EALQNVLVCLEMVVFSVLQQYAYHVAPYSGDAEAKMRLKKK 293 >ref|XP_012443313.1| PREDICTED: transmembrane protein 184C-like [Gossypium raimondii] gi|763790504|gb|KJB57500.1| hypothetical protein B456_009G172600 [Gossypium raimondii] gi|763790505|gb|KJB57501.1| hypothetical protein B456_009G172600 [Gossypium raimondii] gi|763790506|gb|KJB57502.1| hypothetical protein B456_009G172600 [Gossypium raimondii] Length = 295 Score = 68.9 bits (167), Expect = 1e-09 Identities = 33/43 (76%), Positives = 37/43 (86%) Frame = +2 Query: 5 EAIQNVLVCLEMVVFSVLQKYAYPATPYSGDVEAKLKLNKKTE 133 EA+QNVLVCLEMVVF+VLQ+YAY PYSG+ EAKLKL KK E Sbjct: 253 EALQNVLVCLEMVVFAVLQQYAYHVYPYSGETEAKLKLGKKLE 295 >gb|KDP20899.1| hypothetical protein JCGZ_21370 [Jatropha curcas] Length = 289 Score = 68.9 bits (167), Expect = 1e-09 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = +2 Query: 5 EAIQNVLVCLEMVVFSVLQKYAYPATPYSGDVEAKLKLNKK 127 EA+QNVLVCLEMVVFSVLQ+YAY PYSGD EAK++L KK Sbjct: 248 EALQNVLVCLEMVVFSVLQQYAYHVAPYSGDAEAKMRLKKK 288 >ref|XP_004485717.1| PREDICTED: transmembrane protein 184A [Cicer arietinum] Length = 295 Score = 68.9 bits (167), Expect = 1e-09 Identities = 32/43 (74%), Positives = 38/43 (88%) Frame = +2 Query: 5 EAIQNVLVCLEMVVFSVLQKYAYPATPYSGDVEAKLKLNKKTE 133 EA+QN+LVC+EMVVFSVLQ+YAY A+PYSG+VE LK NKK E Sbjct: 253 EAMQNILVCIEMVVFSVLQQYAYHASPYSGEVEKMLKQNKKNE 295 >ref|XP_010057489.1| PREDICTED: transmembrane protein 184C-like [Eucalyptus grandis] gi|629109547|gb|KCW74693.1| hypothetical protein EUGRSUZ_E03424 [Eucalyptus grandis] Length = 294 Score = 67.8 bits (164), Expect = 3e-09 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = +2 Query: 5 EAIQNVLVCLEMVVFSVLQKYAYPATPYSGDVEAKLKLNKK 127 EAIQNVLVCLEMVVFSVLQ+YAY PYSG+ E+KLKL K+ Sbjct: 253 EAIQNVLVCLEMVVFSVLQQYAYHVAPYSGETESKLKLKKR 293