BLASTX nr result
ID: Zanthoxylum22_contig00023345
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00023345 (445 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006447155.1| hypothetical protein CICLE_v10017154mg [Citr... 155 9e-36 gb|AFK34152.1| unknown [Lotus japonicus] 150 5e-34 gb|KHG03339.1| 54S ribosomal L37, mitochondrial [Gossypium arbor... 148 1e-33 ref|XP_007031750.1| Mitochondrial ribosomal protein L37 isoform ... 147 3e-33 ref|XP_010485361.1| PREDICTED: 39S ribosomal protein L54, mitoch... 147 4e-33 ref|XP_010435664.1| PREDICTED: 39S ribosomal protein L54, mitoch... 147 4e-33 ref|XP_010497430.1| PREDICTED: 39S ribosomal protein L54, mitoch... 146 7e-33 ref|XP_002265795.1| PREDICTED: 54S ribosomal protein L37, mitoch... 146 7e-33 ref|XP_006299087.1| hypothetical protein CARUB_v10015225mg [Caps... 146 7e-33 gb|KJB70838.1| hypothetical protein B456_011G092800 [Gossypium r... 145 1e-32 ref|XP_012457195.1| PREDICTED: 39S ribosomal protein L54, mitoch... 145 1e-32 ref|NP_566150.1| mitochondrial ribosomal protein L37 [Arabidopsi... 145 1e-32 ref|XP_014507403.1| PREDICTED: 54S ribosomal protein L37, mitoch... 144 2e-32 gb|KJB74600.1| hypothetical protein B456_012G089400 [Gossypium r... 144 3e-32 ref|XP_012458699.1| PREDICTED: 54S ribosomal protein L37, mitoch... 144 3e-32 ref|XP_012458700.1| PREDICTED: 54S ribosomal protein L37, mitoch... 144 3e-32 ref|XP_010271329.1| PREDICTED: 54S ribosomal protein L37, mitoch... 144 3e-32 ref|XP_007156142.1| hypothetical protein PHAVU_003G262000g [Phas... 144 3e-32 ref|XP_011097320.1| PREDICTED: 54S ribosomal protein L37, mitoch... 143 4e-32 ref|XP_010033374.1| PREDICTED: 39S ribosomal protein L54, mitoch... 143 6e-32 >ref|XP_006447155.1| hypothetical protein CICLE_v10017154mg [Citrus clementina] gi|567909685|ref|XP_006447156.1| hypothetical protein CICLE_v10017154mg [Citrus clementina] gi|568831453|ref|XP_006469980.1| PREDICTED: 39S ribosomal protein L54, mitochondrial-like isoform X1 [Citrus sinensis] gi|568831457|ref|XP_006469981.1| PREDICTED: 39S ribosomal protein L54, mitochondrial-like isoform X2 [Citrus sinensis] gi|557549766|gb|ESR60395.1| hypothetical protein CICLE_v10017154mg [Citrus clementina] gi|557549767|gb|ESR60396.1| hypothetical protein CICLE_v10017154mg [Citrus clementina] gi|641821759|gb|KDO41387.1| hypothetical protein CISIN_1g032859mg [Citrus sinensis] Length = 132 Score = 155 bits (393), Expect = 9e-36 Identities = 76/84 (90%), Positives = 78/84 (92%) Frame = -1 Query: 394 STLSKEVKSTTVVGANILKEGSDPKVLPDSEYPDWLWHLLEKRPALSELRMKNVETLPYG 215 S LSKEVKSTTVVGANILKEGSDPKVLPDSEYPDWLWHLLEKRPALSEL+MKN+ETLPY Sbjct: 49 SILSKEVKSTTVVGANILKEGSDPKVLPDSEYPDWLWHLLEKRPALSELKMKNIETLPYE 108 Query: 214 YLKRFFKLDNREKIKENNSTKAKN 143 LKRF KLDNR KIKENNS KAKN Sbjct: 109 DLKRFLKLDNRAKIKENNSVKAKN 132 >gb|AFK34152.1| unknown [Lotus japonicus] Length = 131 Score = 150 bits (378), Expect = 5e-34 Identities = 71/84 (84%), Positives = 78/84 (92%) Frame = -1 Query: 394 STLSKEVKSTTVVGANILKEGSDPKVLPDSEYPDWLWHLLEKRPALSELRMKNVETLPYG 215 S+LSKEVKS+TVVGANILKEGSDPK+LPDSEYPDWLWHLL+KRPALSELR KN+ETL Y Sbjct: 48 SSLSKEVKSSTVVGANILKEGSDPKILPDSEYPDWLWHLLDKRPALSELRRKNIETLSYE 107 Query: 214 YLKRFFKLDNREKIKENNSTKAKN 143 YLKR+ KLDNR +IKENNS KAKN Sbjct: 108 YLKRYVKLDNRARIKENNSLKAKN 131 >gb|KHG03339.1| 54S ribosomal L37, mitochondrial [Gossypium arboreum] Length = 131 Score = 148 bits (374), Expect = 1e-33 Identities = 70/84 (83%), Positives = 77/84 (91%) Frame = -1 Query: 394 STLSKEVKSTTVVGANILKEGSDPKVLPDSEYPDWLWHLLEKRPALSELRMKNVETLPYG 215 S LSKEVKSTTVVGANILK+G+DPK++PDSEYPDWLWHLL+KRPALSELR KN+ETLPY Sbjct: 48 SVLSKEVKSTTVVGANILKDGTDPKIMPDSEYPDWLWHLLDKRPALSELRRKNIETLPYE 107 Query: 214 YLKRFFKLDNREKIKENNSTKAKN 143 LKRF KLDNR +IKENNS KAKN Sbjct: 108 DLKRFVKLDNRARIKENNSIKAKN 131 >ref|XP_007031750.1| Mitochondrial ribosomal protein L37 isoform 1 [Theobroma cacao] gi|590646903|ref|XP_007031751.1| Mitochondrial ribosomal protein L37 isoform 1 [Theobroma cacao] gi|590646906|ref|XP_007031752.1| Mitochondrial ribosomal protein L37 isoform 1 [Theobroma cacao] gi|590646909|ref|XP_007031753.1| Mitochondrial ribosomal protein L37 isoform 1 [Theobroma cacao] gi|590646912|ref|XP_007031754.1| Mitochondrial ribosomal protein L37 isoform 1 [Theobroma cacao] gi|508710779|gb|EOY02676.1| Mitochondrial ribosomal protein L37 isoform 1 [Theobroma cacao] gi|508710780|gb|EOY02677.1| Mitochondrial ribosomal protein L37 isoform 1 [Theobroma cacao] gi|508710781|gb|EOY02678.1| Mitochondrial ribosomal protein L37 isoform 1 [Theobroma cacao] gi|508710782|gb|EOY02679.1| Mitochondrial ribosomal protein L37 isoform 1 [Theobroma cacao] gi|508710783|gb|EOY02680.1| Mitochondrial ribosomal protein L37 isoform 1 [Theobroma cacao] Length = 131 Score = 147 bits (371), Expect = 3e-33 Identities = 69/84 (82%), Positives = 77/84 (91%) Frame = -1 Query: 394 STLSKEVKSTTVVGANILKEGSDPKVLPDSEYPDWLWHLLEKRPALSELRMKNVETLPYG 215 S LSKEVKSTTVVGANILK+G+DPK++PDSEYPDWLWHLL+KRPALSELR KN+ETLPY Sbjct: 48 SILSKEVKSTTVVGANILKDGADPKIMPDSEYPDWLWHLLDKRPALSELRRKNIETLPYE 107 Query: 214 YLKRFFKLDNREKIKENNSTKAKN 143 LKRF KLDNR +IKENN+ KAKN Sbjct: 108 DLKRFVKLDNRARIKENNAVKAKN 131 >ref|XP_010485361.1| PREDICTED: 39S ribosomal protein L54, mitochondrial-like isoform X1 [Camelina sativa] Length = 169 Score = 147 bits (370), Expect = 4e-33 Identities = 69/84 (82%), Positives = 76/84 (90%) Frame = -1 Query: 394 STLSKEVKSTTVVGANILKEGSDPKVLPDSEYPDWLWHLLEKRPALSELRMKNVETLPYG 215 S+LSKE+KSTTVVGAN LKEGSDPK+LPDS+YP WLWHLL+KRPALSELR KNVETLPY Sbjct: 86 SSLSKEIKSTTVVGANTLKEGSDPKILPDSDYPQWLWHLLDKRPALSELRRKNVETLPYD 145 Query: 214 YLKRFFKLDNREKIKENNSTKAKN 143 +LKRF KLD R KIK+NNS KAKN Sbjct: 146 HLKRFVKLDTRAKIKDNNSVKAKN 169 >ref|XP_010435664.1| PREDICTED: 39S ribosomal protein L54, mitochondrial-like [Camelina sativa] gi|727628883|ref|XP_010485362.1| PREDICTED: 39S ribosomal protein L54, mitochondrial-like isoform X2 [Camelina sativa] gi|727628885|ref|XP_010485363.1| PREDICTED: 39S ribosomal protein L54, mitochondrial-like isoform X2 [Camelina sativa] Length = 127 Score = 147 bits (370), Expect = 4e-33 Identities = 69/84 (82%), Positives = 76/84 (90%) Frame = -1 Query: 394 STLSKEVKSTTVVGANILKEGSDPKVLPDSEYPDWLWHLLEKRPALSELRMKNVETLPYG 215 S+LSKE+KSTTVVGAN LKEGSDPK+LPDS+YP WLWHLL+KRPALSELR KNVETLPY Sbjct: 44 SSLSKEIKSTTVVGANTLKEGSDPKILPDSDYPQWLWHLLDKRPALSELRRKNVETLPYD 103 Query: 214 YLKRFFKLDNREKIKENNSTKAKN 143 +LKRF KLD R KIK+NNS KAKN Sbjct: 104 HLKRFVKLDTRAKIKDNNSVKAKN 127 >ref|XP_010497430.1| PREDICTED: 39S ribosomal protein L54, mitochondrial-like, partial [Camelina sativa] Length = 120 Score = 146 bits (368), Expect = 7e-33 Identities = 70/84 (83%), Positives = 75/84 (89%) Frame = -1 Query: 394 STLSKEVKSTTVVGANILKEGSDPKVLPDSEYPDWLWHLLEKRPALSELRMKNVETLPYG 215 S+LSKE+KSTTVVGAN LKEGSDPK+LPDS+YP WLWHLL+KRPALSELR KNVETLPY Sbjct: 37 SSLSKEIKSTTVVGANTLKEGSDPKILPDSDYPQWLWHLLDKRPALSELRRKNVETLPYD 96 Query: 214 YLKRFFKLDNREKIKENNSTKAKN 143 LKRF KLD R KIKENNS KAKN Sbjct: 97 DLKRFVKLDTRAKIKENNSVKAKN 120 >ref|XP_002265795.1| PREDICTED: 54S ribosomal protein L37, mitochondrial [Vitis vinifera] gi|731418786|ref|XP_010660804.1| PREDICTED: 54S ribosomal protein L37, mitochondrial [Vitis vinifera] Length = 132 Score = 146 bits (368), Expect = 7e-33 Identities = 70/84 (83%), Positives = 77/84 (91%) Frame = -1 Query: 394 STLSKEVKSTTVVGANILKEGSDPKVLPDSEYPDWLWHLLEKRPALSELRMKNVETLPYG 215 STLSKEVKSTT VGANILK+G+DPKVLPDSEYPDWLWHLL+KRPALSELR K+VE+LPY Sbjct: 49 STLSKEVKSTTTVGANILKDGTDPKVLPDSEYPDWLWHLLDKRPALSELRRKSVESLPYE 108 Query: 214 YLKRFFKLDNREKIKENNSTKAKN 143 LKRF KLDNR +IKENN+ KAKN Sbjct: 109 ALKRFVKLDNRARIKENNNLKAKN 132 >ref|XP_006299087.1| hypothetical protein CARUB_v10015225mg [Capsella rubella] gi|482567796|gb|EOA31985.1| hypothetical protein CARUB_v10015225mg [Capsella rubella] Length = 125 Score = 146 bits (368), Expect = 7e-33 Identities = 69/84 (82%), Positives = 76/84 (90%) Frame = -1 Query: 394 STLSKEVKSTTVVGANILKEGSDPKVLPDSEYPDWLWHLLEKRPALSELRMKNVETLPYG 215 S+LSKE+KSTTVVGAN LK+GSDPK+LPDS+YPDWLWHLL+KRPALSELR KNVETLPY Sbjct: 42 SSLSKEIKSTTVVGANTLKDGSDPKILPDSDYPDWLWHLLDKRPALSELRRKNVETLPYD 101 Query: 214 YLKRFFKLDNREKIKENNSTKAKN 143 LKRF KLD R KIK+NNS KAKN Sbjct: 102 DLKRFVKLDTRAKIKDNNSVKAKN 125 >gb|KJB70838.1| hypothetical protein B456_011G092800 [Gossypium raimondii] Length = 147 Score = 145 bits (366), Expect = 1e-32 Identities = 69/84 (82%), Positives = 76/84 (90%) Frame = -1 Query: 394 STLSKEVKSTTVVGANILKEGSDPKVLPDSEYPDWLWHLLEKRPALSELRMKNVETLPYG 215 S LSKEVKSTTVVGANILK+G+DPK++PDSEYPDW+WHLL+KRPALSELR KN+ETLPY Sbjct: 64 SILSKEVKSTTVVGANILKDGTDPKIMPDSEYPDWVWHLLDKRPALSELRRKNIETLPYE 123 Query: 214 YLKRFFKLDNREKIKENNSTKAKN 143 LKRF KLDNR IKENNS KAKN Sbjct: 124 DLKRFVKLDNRALIKENNSIKAKN 147 >ref|XP_012457195.1| PREDICTED: 39S ribosomal protein L54, mitochondrial-like [Gossypium raimondii] gi|823249089|ref|XP_012457196.1| PREDICTED: 39S ribosomal protein L54, mitochondrial-like [Gossypium raimondii] gi|763803899|gb|KJB70837.1| hypothetical protein B456_011G092800 [Gossypium raimondii] gi|763803901|gb|KJB70839.1| hypothetical protein B456_011G092800 [Gossypium raimondii] Length = 131 Score = 145 bits (366), Expect = 1e-32 Identities = 69/84 (82%), Positives = 76/84 (90%) Frame = -1 Query: 394 STLSKEVKSTTVVGANILKEGSDPKVLPDSEYPDWLWHLLEKRPALSELRMKNVETLPYG 215 S LSKEVKSTTVVGANILK+G+DPK++PDSEYPDW+WHLL+KRPALSELR KN+ETLPY Sbjct: 48 SILSKEVKSTTVVGANILKDGTDPKIMPDSEYPDWVWHLLDKRPALSELRRKNIETLPYE 107 Query: 214 YLKRFFKLDNREKIKENNSTKAKN 143 LKRF KLDNR IKENNS KAKN Sbjct: 108 DLKRFVKLDNRALIKENNSIKAKN 131 >ref|NP_566150.1| mitochondrial ribosomal protein L37 [Arabidopsis thaliana] gi|6016731|gb|AAF01557.1|AC009325_27 unknown protein [Arabidopsis thaliana] gi|6091718|gb|AAF03430.1|AC010797_6 unknown protein [Arabidopsis thaliana] gi|21592342|gb|AAM64293.1| unknown [Arabidopsis thaliana] gi|28393066|gb|AAO41967.1| unknown protein [Arabidopsis thaliana] gi|28827392|gb|AAO50540.1| unknown protein [Arabidopsis thaliana] gi|332640188|gb|AEE73709.1| mitochondrial ribosomal protein L37 [Arabidopsis thaliana] Length = 126 Score = 145 bits (366), Expect = 1e-32 Identities = 69/84 (82%), Positives = 76/84 (90%) Frame = -1 Query: 394 STLSKEVKSTTVVGANILKEGSDPKVLPDSEYPDWLWHLLEKRPALSELRMKNVETLPYG 215 S+L+KE+KSTTVVGAN LK+GSDPK+LPDS+YPDWLWHLL+KRPALSELR KNVETLPY Sbjct: 43 SSLTKEIKSTTVVGANTLKDGSDPKILPDSDYPDWLWHLLDKRPALSELRRKNVETLPYD 102 Query: 214 YLKRFFKLDNREKIKENNSTKAKN 143 LKRF KLD R KIKENNS KAKN Sbjct: 103 DLKRFVKLDTRGKIKENNSIKAKN 126 >ref|XP_014507403.1| PREDICTED: 54S ribosomal protein L37, mitochondrial [Vigna radiata var. radiata] gi|951002674|ref|XP_014507404.1| PREDICTED: 54S ribosomal protein L37, mitochondrial [Vigna radiata var. radiata] Length = 131 Score = 144 bits (364), Expect = 2e-32 Identities = 69/84 (82%), Positives = 77/84 (91%) Frame = -1 Query: 394 STLSKEVKSTTVVGANILKEGSDPKVLPDSEYPDWLWHLLEKRPALSELRMKNVETLPYG 215 STLSKEVK++TVVGANILKEG+DPK+LPDSEYPDWLWHLL+KRPALSELR KN+ETL Y Sbjct: 48 STLSKEVKASTVVGANILKEGTDPKILPDSEYPDWLWHLLDKRPALSELRRKNIETLSYE 107 Query: 214 YLKRFFKLDNREKIKENNSTKAKN 143 LKRF KLDNR +IKE+NS KAKN Sbjct: 108 DLKRFVKLDNRARIKESNSLKAKN 131 >gb|KJB74600.1| hypothetical protein B456_012G089400 [Gossypium raimondii] Length = 126 Score = 144 bits (363), Expect = 3e-32 Identities = 69/84 (82%), Positives = 76/84 (90%) Frame = -1 Query: 394 STLSKEVKSTTVVGANILKEGSDPKVLPDSEYPDWLWHLLEKRPALSELRMKNVETLPYG 215 STLSKEVKSTTVVGANILK+G+DPK+ DSEYPDWLWHLL+KRPALSELR K++ETLPY Sbjct: 43 STLSKEVKSTTVVGANILKDGADPKIFLDSEYPDWLWHLLDKRPALSELRRKDIETLPYE 102 Query: 214 YLKRFFKLDNREKIKENNSTKAKN 143 LKRF KLDNR +IKENNS KAKN Sbjct: 103 DLKRFVKLDNRARIKENNSVKAKN 126 >ref|XP_012458699.1| PREDICTED: 54S ribosomal protein L37, mitochondrial isoform X1 [Gossypium raimondii] gi|763807697|gb|KJB74599.1| hypothetical protein B456_012G089400 [Gossypium raimondii] Length = 144 Score = 144 bits (363), Expect = 3e-32 Identities = 69/84 (82%), Positives = 76/84 (90%) Frame = -1 Query: 394 STLSKEVKSTTVVGANILKEGSDPKVLPDSEYPDWLWHLLEKRPALSELRMKNVETLPYG 215 STLSKEVKSTTVVGANILK+G+DPK+ DSEYPDWLWHLL+KRPALSELR K++ETLPY Sbjct: 61 STLSKEVKSTTVVGANILKDGADPKIFLDSEYPDWLWHLLDKRPALSELRRKDIETLPYE 120 Query: 214 YLKRFFKLDNREKIKENNSTKAKN 143 LKRF KLDNR +IKENNS KAKN Sbjct: 121 DLKRFVKLDNRARIKENNSVKAKN 144 >ref|XP_012458700.1| PREDICTED: 54S ribosomal protein L37, mitochondrial isoform X2 [Gossypium raimondii] gi|763807696|gb|KJB74598.1| hypothetical protein B456_012G089400 [Gossypium raimondii] Length = 131 Score = 144 bits (363), Expect = 3e-32 Identities = 69/84 (82%), Positives = 76/84 (90%) Frame = -1 Query: 394 STLSKEVKSTTVVGANILKEGSDPKVLPDSEYPDWLWHLLEKRPALSELRMKNVETLPYG 215 STLSKEVKSTTVVGANILK+G+DPK+ DSEYPDWLWHLL+KRPALSELR K++ETLPY Sbjct: 48 STLSKEVKSTTVVGANILKDGADPKIFLDSEYPDWLWHLLDKRPALSELRRKDIETLPYE 107 Query: 214 YLKRFFKLDNREKIKENNSTKAKN 143 LKRF KLDNR +IKENNS KAKN Sbjct: 108 DLKRFVKLDNRARIKENNSVKAKN 131 >ref|XP_010271329.1| PREDICTED: 54S ribosomal protein L37, mitochondrial-like [Nelumbo nucifera] Length = 132 Score = 144 bits (362), Expect = 3e-32 Identities = 67/84 (79%), Positives = 76/84 (90%) Frame = -1 Query: 394 STLSKEVKSTTVVGANILKEGSDPKVLPDSEYPDWLWHLLEKRPALSELRMKNVETLPYG 215 S LSKE+KSTTVVGANILK+G+DPK+LPDSEYPDWLWHLL+K+PALSELR KN+ETLPY Sbjct: 49 SILSKEMKSTTVVGANILKDGADPKILPDSEYPDWLWHLLDKKPALSELRRKNIETLPYD 108 Query: 214 YLKRFFKLDNREKIKENNSTKAKN 143 LKRF KLDNR +IKENN +AKN Sbjct: 109 ELKRFVKLDNRARIKENNVIRAKN 132 >ref|XP_007156142.1| hypothetical protein PHAVU_003G262000g [Phaseolus vulgaris] gi|593786205|ref|XP_007156143.1| hypothetical protein PHAVU_003G262000g [Phaseolus vulgaris] gi|561029496|gb|ESW28136.1| hypothetical protein PHAVU_003G262000g [Phaseolus vulgaris] gi|561029497|gb|ESW28137.1| hypothetical protein PHAVU_003G262000g [Phaseolus vulgaris] Length = 130 Score = 144 bits (362), Expect = 3e-32 Identities = 68/84 (80%), Positives = 75/84 (89%) Frame = -1 Query: 394 STLSKEVKSTTVVGANILKEGSDPKVLPDSEYPDWLWHLLEKRPALSELRMKNVETLPYG 215 STLSKE+KS+T VGANILKEG+DPK+LPDS+YPDWLWHLL+KRPALSELR KNVETL Y Sbjct: 47 STLSKEIKSSTTVGANILKEGTDPKILPDSDYPDWLWHLLDKRPALSELRRKNVETLSYD 106 Query: 214 YLKRFFKLDNREKIKENNSTKAKN 143 LK F KLDNR +IKENNS KAKN Sbjct: 107 NLKHFVKLDNRARIKENNSMKAKN 130 >ref|XP_011097320.1| PREDICTED: 54S ribosomal protein L37, mitochondrial [Sesamum indicum] Length = 132 Score = 143 bits (361), Expect = 4e-32 Identities = 69/84 (82%), Positives = 75/84 (89%) Frame = -1 Query: 394 STLSKEVKSTTVVGANILKEGSDPKVLPDSEYPDWLWHLLEKRPALSELRMKNVETLPYG 215 S LSKEVKSTTV GANILK+G DPK+LPDSEYPDWLWHLL+KRPALSELR K+VE+LPY Sbjct: 49 SLLSKEVKSTTVFGANILKDGQDPKILPDSEYPDWLWHLLDKRPALSELRRKDVESLPYE 108 Query: 214 YLKRFFKLDNREKIKENNSTKAKN 143 LKRF KLDNR +IKENNS KAKN Sbjct: 109 DLKRFVKLDNRARIKENNSLKAKN 132 >ref|XP_010033374.1| PREDICTED: 39S ribosomal protein L54, mitochondrial-like [Eucalyptus grandis] gi|702481840|ref|XP_010033375.1| PREDICTED: 39S ribosomal protein L54, mitochondrial-like [Eucalyptus grandis] gi|702481844|ref|XP_010033376.1| PREDICTED: 39S ribosomal protein L54, mitochondrial-like [Eucalyptus grandis] gi|629086637|gb|KCW52994.1| hypothetical protein EUGRSUZ_J02294 [Eucalyptus grandis] gi|629086638|gb|KCW52995.1| hypothetical protein EUGRSUZ_J02294 [Eucalyptus grandis] Length = 133 Score = 143 bits (360), Expect = 6e-32 Identities = 70/84 (83%), Positives = 76/84 (90%) Frame = -1 Query: 394 STLSKEVKSTTVVGANILKEGSDPKVLPDSEYPDWLWHLLEKRPALSELRMKNVETLPYG 215 STLSKEVKSTTVVGANILK+G+DPKVLPDSEYPDWL HL++K+P LSELR KNVETLPY Sbjct: 50 STLSKEVKSTTVVGANILKDGADPKVLPDSEYPDWLCHLIDKKPPLSELRRKNVETLPYE 109 Query: 214 YLKRFFKLDNREKIKENNSTKAKN 143 LKRF KLDNR +IKENNS KAKN Sbjct: 110 DLKRFVKLDNRARIKENNSIKAKN 133