BLASTX nr result
ID: Zanthoxylum22_contig00023088
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00023088 (375 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006453439.1| hypothetical protein CICLE_v10009608mg [Citr... 62 2e-07 >ref|XP_006453439.1| hypothetical protein CICLE_v10009608mg [Citrus clementina] gi|568840369|ref|XP_006474141.1| PREDICTED: uncharacterized protein At4g14100-like [Citrus sinensis] gi|557556665|gb|ESR66679.1| hypothetical protein CICLE_v10009608mg [Citrus clementina] gi|641807731|gb|KDO36384.1| hypothetical protein CISIN_1g029792mg [Citrus sinensis] Length = 188 Score = 62.0 bits (149), Expect = 2e-07 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -3 Query: 373 DGISVYVFTFEVGAVLHDPLIQAPPYCFSQATDAK 269 DGISV+V TFEVGAVLHDPLIQAP YCF+Q T AK Sbjct: 153 DGISVHVMTFEVGAVLHDPLIQAPSYCFNQDTYAK 187