BLASTX nr result
ID: Zanthoxylum22_contig00021936
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00021936 (267 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006434977.1| hypothetical protein CICLE_v10002080mg [Citr... 57 4e-06 >ref|XP_006434977.1| hypothetical protein CICLE_v10002080mg [Citrus clementina] gi|567884839|ref|XP_006434978.1| hypothetical protein CICLE_v10002080mg [Citrus clementina] gi|567884841|ref|XP_006434979.1| hypothetical protein CICLE_v10002080mg [Citrus clementina] gi|568839007|ref|XP_006473487.1| PREDICTED: CRAL-TRIO domain-containing protein C23B6.04c-like isoform X1 [Citrus sinensis] gi|568839009|ref|XP_006473488.1| PREDICTED: CRAL-TRIO domain-containing protein C23B6.04c-like isoform X2 [Citrus sinensis] gi|568839011|ref|XP_006473489.1| PREDICTED: CRAL-TRIO domain-containing protein C23B6.04c-like isoform X3 [Citrus sinensis] gi|557537099|gb|ESR48217.1| hypothetical protein CICLE_v10002080mg [Citrus clementina] gi|557537100|gb|ESR48218.1| hypothetical protein CICLE_v10002080mg [Citrus clementina] gi|557537101|gb|ESR48219.1| hypothetical protein CICLE_v10002080mg [Citrus clementina] Length = 286 Score = 57.4 bits (137), Expect = 4e-06 Identities = 32/41 (78%), Positives = 32/41 (78%) Frame = -3 Query: 124 MFRKKNNTHHDQQESEEQLHESKVKELKAAIEPPSGRSLQY 2 MFRKKNNT QESEE HESKVKELKAAI P GRSLQY Sbjct: 1 MFRKKNNT----QESEEHHHESKVKELKAAIGPLYGRSLQY 37