BLASTX nr result
ID: Zanthoxylum22_contig00021887
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00021887 (394 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006452643.1| hypothetical protein CICLE_v10009293mg [Citr... 63 8e-08 >ref|XP_006452643.1| hypothetical protein CICLE_v10009293mg [Citrus clementina] gi|557555869|gb|ESR65883.1| hypothetical protein CICLE_v10009293mg [Citrus clementina] gi|641840267|gb|KDO59189.1| hypothetical protein CISIN_1g018875mg [Citrus sinensis] Length = 247 Score = 63.2 bits (152), Expect = 8e-08 Identities = 33/55 (60%), Positives = 39/55 (70%) Frame = -1 Query: 391 FLFIVNHALLHFLFTLRIYQHGVVYSVDIST*PNSIVEFLKLFRIIIVRDCYRYR 227 +LFIV + LL FLF LRIYQ +VYS+D NSI+ FLK+F III CYRYR Sbjct: 193 YLFIVYNVLLLFLFALRIYQPRIVYSIDTVYVQNSILVFLKIFLIIIGGGCYRYR 247