BLASTX nr result
ID: Zanthoxylum22_contig00021748
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00021748 (539 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO54224.1| hypothetical protein CISIN_1g006091mg [Citrus sin... 89 2e-15 ref|XP_013599012.1| PREDICTED: starch synthase 1, chloroplastic/... 80 6e-13 ref|XP_010671436.1| PREDICTED: starch synthase 1, chloroplastic/... 80 6e-13 ref|XP_013711391.1| PREDICTED: starch synthase 1, chloroplastic/... 80 6e-13 ref|XP_009150951.1| PREDICTED: starch synthase 1, chloroplastic/... 80 6e-13 gb|KDO54223.1| hypothetical protein CISIN_1g006091mg [Citrus sin... 80 6e-13 gb|KDO54222.1| hypothetical protein CISIN_1g006091mg [Citrus sin... 80 6e-13 ref|XP_006493328.1| PREDICTED: starch synthase 1, chloroplastic/... 80 6e-13 ref|XP_012458636.1| PREDICTED: soluble starch synthase 1, chloro... 80 8e-13 gb|KCW46565.1| hypothetical protein EUGRSUZ_K00387 [Eucalyptus g... 80 8e-13 ref|XP_010035274.1| PREDICTED: soluble starch synthase 1, chloro... 80 8e-13 gb|KNA22338.1| hypothetical protein SOVF_034930 [Spinacia oleracea] 79 1e-12 ref|XP_010318024.1| PREDICTED: soluble starch synthase 1, chloro... 79 1e-12 ref|XP_009782631.1| PREDICTED: soluble starch synthase 1, chloro... 79 1e-12 ref|XP_009624828.1| PREDICTED: soluble starch synthase 1, chloro... 79 1e-12 ref|XP_009624826.1| PREDICTED: soluble starch synthase 1, chloro... 79 1e-12 ref|XP_009624825.1| PREDICTED: soluble starch synthase 1, chloro... 79 1e-12 ref|XP_009624824.1| PREDICTED: soluble starch synthase 1, chloro... 79 1e-12 ref|XP_004234971.1| PREDICTED: soluble starch synthase 1, chloro... 79 1e-12 ref|NP_001275074.1| soluble starch synthase 1, chloroplastic/amy... 79 2e-12 >gb|KDO54224.1| hypothetical protein CISIN_1g006091mg [Citrus sinensis] Length = 606 Score = 88.6 bits (218), Expect = 2e-15 Identities = 46/68 (67%), Positives = 48/68 (70%) Frame = -3 Query: 441 CDILLMPSRFEPCGLNQLYAMRYGTIPVVHATGGLRVSSSIHDIKCEHMYSPLLRHLIFK 262 CDILLMPSRFEPCGLNQLYAMRYGTIPVVHATGGLR +SIH LL + K Sbjct: 543 CDILLMPSRFEPCGLNQLYAMRYGTIPVVHATGGLRWKTSIH----------LLEKAVVK 592 Query: 261 VQTRNFMH 238 VQ F H Sbjct: 593 VQGGPFCH 600 >ref|XP_013599012.1| PREDICTED: starch synthase 1, chloroplastic/amyloplastic [Brassica oleracea var. oleracea] Length = 651 Score = 80.1 bits (196), Expect = 6e-13 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -3 Query: 441 CDILLMPSRFEPCGLNQLYAMRYGTIPVVHATGGLR 334 CDILLMPSRFEPCGLNQLYAMRYGTIPVVHATGGLR Sbjct: 532 CDILLMPSRFEPCGLNQLYAMRYGTIPVVHATGGLR 567 >ref|XP_010671436.1| PREDICTED: starch synthase 1, chloroplastic/amyloplastic [Beta vulgaris subsp. vulgaris] gi|870864932|gb|KMT15999.1| hypothetical protein BVRB_3g051810 [Beta vulgaris subsp. vulgaris] Length = 705 Score = 80.1 bits (196), Expect = 6e-13 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -3 Query: 441 CDILLMPSRFEPCGLNQLYAMRYGTIPVVHATGGLR 334 CDILLMPSRFEPCGLNQLYAMRYGTIPVVHATGGLR Sbjct: 585 CDILLMPSRFEPCGLNQLYAMRYGTIPVVHATGGLR 620 >ref|XP_013711391.1| PREDICTED: starch synthase 1, chloroplastic/amyloplastic [Brassica napus] gi|674952866|emb|CDX80428.1| BnaC07g30160D [Brassica napus] Length = 651 Score = 80.1 bits (196), Expect = 6e-13 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -3 Query: 441 CDILLMPSRFEPCGLNQLYAMRYGTIPVVHATGGLR 334 CDILLMPSRFEPCGLNQLYAMRYGTIPVVHATGGLR Sbjct: 532 CDILLMPSRFEPCGLNQLYAMRYGTIPVVHATGGLR 567 >ref|XP_009150951.1| PREDICTED: starch synthase 1, chloroplastic/amyloplastic [Brassica rapa] gi|923647824|ref|XP_013643436.1| PREDICTED: starch synthase 1, chloroplastic/amyloplastic [Brassica napus] gi|674945291|emb|CDX88091.1| BnaA06g26820D [Brassica napus] Length = 651 Score = 80.1 bits (196), Expect = 6e-13 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -3 Query: 441 CDILLMPSRFEPCGLNQLYAMRYGTIPVVHATGGLR 334 CDILLMPSRFEPCGLNQLYAMRYGTIPVVHATGGLR Sbjct: 532 CDILLMPSRFEPCGLNQLYAMRYGTIPVVHATGGLR 567 >gb|KDO54223.1| hypothetical protein CISIN_1g006091mg [Citrus sinensis] Length = 576 Score = 80.1 bits (196), Expect = 6e-13 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -3 Query: 441 CDILLMPSRFEPCGLNQLYAMRYGTIPVVHATGGLR 334 CDILLMPSRFEPCGLNQLYAMRYGTIPVVHATGGLR Sbjct: 457 CDILLMPSRFEPCGLNQLYAMRYGTIPVVHATGGLR 492 >gb|KDO54222.1| hypothetical protein CISIN_1g006091mg [Citrus sinensis] Length = 662 Score = 80.1 bits (196), Expect = 6e-13 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -3 Query: 441 CDILLMPSRFEPCGLNQLYAMRYGTIPVVHATGGLR 334 CDILLMPSRFEPCGLNQLYAMRYGTIPVVHATGGLR Sbjct: 543 CDILLMPSRFEPCGLNQLYAMRYGTIPVVHATGGLR 578 >ref|XP_006493328.1| PREDICTED: starch synthase 1, chloroplastic/amyloplastic-like [Citrus sinensis] gi|568884290|ref|XP_006494844.1| PREDICTED: starch synthase 1, chloroplastic/amyloplastic-like [Citrus sinensis] Length = 662 Score = 80.1 bits (196), Expect = 6e-13 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -3 Query: 441 CDILLMPSRFEPCGLNQLYAMRYGTIPVVHATGGLR 334 CDILLMPSRFEPCGLNQLYAMRYGTIPVVHATGGLR Sbjct: 543 CDILLMPSRFEPCGLNQLYAMRYGTIPVVHATGGLR 578 >ref|XP_012458636.1| PREDICTED: soluble starch synthase 1, chloroplastic/amyloplastic-like [Gossypium raimondii] gi|763807777|gb|KJB74679.1| hypothetical protein B456_012G002300 [Gossypium raimondii] Length = 647 Score = 79.7 bits (195), Expect = 8e-13 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -3 Query: 441 CDILLMPSRFEPCGLNQLYAMRYGTIPVVHATGGLR 334 CDILLMPSRFEPCGLNQLYAMRYGT+PVVHATGGLR Sbjct: 528 CDILLMPSRFEPCGLNQLYAMRYGTVPVVHATGGLR 563 >gb|KCW46565.1| hypothetical protein EUGRSUZ_K00387 [Eucalyptus grandis] Length = 619 Score = 79.7 bits (195), Expect = 8e-13 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -3 Query: 441 CDILLMPSRFEPCGLNQLYAMRYGTIPVVHATGGLR 334 CDILLMPSRFEPCGLNQLYAMRYGT+PVVHATGGLR Sbjct: 545 CDILLMPSRFEPCGLNQLYAMRYGTVPVVHATGGLR 580 >ref|XP_010035274.1| PREDICTED: soluble starch synthase 1, chloroplastic/amyloplastic [Eucalyptus grandis] gi|629080119|gb|KCW46564.1| hypothetical protein EUGRSUZ_K00387 [Eucalyptus grandis] Length = 664 Score = 79.7 bits (195), Expect = 8e-13 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -3 Query: 441 CDILLMPSRFEPCGLNQLYAMRYGTIPVVHATGGLR 334 CDILLMPSRFEPCGLNQLYAMRYGT+PVVHATGGLR Sbjct: 545 CDILLMPSRFEPCGLNQLYAMRYGTVPVVHATGGLR 580 >gb|KNA22338.1| hypothetical protein SOVF_034930 [Spinacia oleracea] Length = 683 Score = 79.0 bits (193), Expect = 1e-12 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -3 Query: 441 CDILLMPSRFEPCGLNQLYAMRYGTIPVVHATGGLR 334 CDILLMPSRFEPCGLNQLYAMRYGTIPVVH+TGGLR Sbjct: 563 CDILLMPSRFEPCGLNQLYAMRYGTIPVVHSTGGLR 598 >ref|XP_010318024.1| PREDICTED: soluble starch synthase 1, chloroplastic/amyloplastic isoform X2 [Solanum lycopersicum] Length = 639 Score = 79.0 bits (193), Expect = 1e-12 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -3 Query: 441 CDILLMPSRFEPCGLNQLYAMRYGTIPVVHATGGLR 334 CDILLMPSRFEPCGLNQLYAMRYGTIPVVH+TGGLR Sbjct: 520 CDILLMPSRFEPCGLNQLYAMRYGTIPVVHSTGGLR 555 >ref|XP_009782631.1| PREDICTED: soluble starch synthase 1, chloroplastic/amyloplastic [Nicotiana sylvestris] Length = 650 Score = 79.0 bits (193), Expect = 1e-12 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -3 Query: 441 CDILLMPSRFEPCGLNQLYAMRYGTIPVVHATGGLR 334 CDILLMPSRFEPCGLNQLYAMRYGTIPVVH+TGGLR Sbjct: 531 CDILLMPSRFEPCGLNQLYAMRYGTIPVVHSTGGLR 566 >ref|XP_009624828.1| PREDICTED: soluble starch synthase 1, chloroplastic/amyloplastic isoform X4 [Nicotiana tomentosiformis] Length = 616 Score = 79.0 bits (193), Expect = 1e-12 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -3 Query: 441 CDILLMPSRFEPCGLNQLYAMRYGTIPVVHATGGLR 334 CDILLMPSRFEPCGLNQLYAMRYGTIPVVH+TGGLR Sbjct: 497 CDILLMPSRFEPCGLNQLYAMRYGTIPVVHSTGGLR 532 >ref|XP_009624826.1| PREDICTED: soluble starch synthase 1, chloroplastic/amyloplastic isoform X3 [Nicotiana tomentosiformis] gi|697141421|ref|XP_009624827.1| PREDICTED: soluble starch synthase 1, chloroplastic/amyloplastic isoform X3 [Nicotiana tomentosiformis] Length = 638 Score = 79.0 bits (193), Expect = 1e-12 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -3 Query: 441 CDILLMPSRFEPCGLNQLYAMRYGTIPVVHATGGLR 334 CDILLMPSRFEPCGLNQLYAMRYGTIPVVH+TGGLR Sbjct: 519 CDILLMPSRFEPCGLNQLYAMRYGTIPVVHSTGGLR 554 >ref|XP_009624825.1| PREDICTED: soluble starch synthase 1, chloroplastic/amyloplastic isoform X2 [Nicotiana tomentosiformis] Length = 648 Score = 79.0 bits (193), Expect = 1e-12 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -3 Query: 441 CDILLMPSRFEPCGLNQLYAMRYGTIPVVHATGGLR 334 CDILLMPSRFEPCGLNQLYAMRYGTIPVVH+TGGLR Sbjct: 529 CDILLMPSRFEPCGLNQLYAMRYGTIPVVHSTGGLR 564 >ref|XP_009624824.1| PREDICTED: soluble starch synthase 1, chloroplastic/amyloplastic isoform X1 [Nicotiana tomentosiformis] Length = 650 Score = 79.0 bits (193), Expect = 1e-12 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -3 Query: 441 CDILLMPSRFEPCGLNQLYAMRYGTIPVVHATGGLR 334 CDILLMPSRFEPCGLNQLYAMRYGTIPVVH+TGGLR Sbjct: 531 CDILLMPSRFEPCGLNQLYAMRYGTIPVVHSTGGLR 566 >ref|XP_004234971.1| PREDICTED: soluble starch synthase 1, chloroplastic/amyloplastic isoform X1 [Solanum lycopersicum] gi|723682231|ref|XP_010318023.1| PREDICTED: soluble starch synthase 1, chloroplastic/amyloplastic isoform X1 [Solanum lycopersicum] Length = 641 Score = 79.0 bits (193), Expect = 1e-12 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -3 Query: 441 CDILLMPSRFEPCGLNQLYAMRYGTIPVVHATGGLR 334 CDILLMPSRFEPCGLNQLYAMRYGTIPVVH+TGGLR Sbjct: 522 CDILLMPSRFEPCGLNQLYAMRYGTIPVVHSTGGLR 557 >ref|NP_001275074.1| soluble starch synthase 1, chloroplastic/amyloplastic [Solanum tuberosum] gi|2829792|sp|P93568.1|SSY1_SOLTU RecName: Full=Soluble starch synthase 1, chloroplastic/amyloplastic; AltName: Full=Soluble starch synthase I; Short=SS I; Flags: Precursor gi|1781353|emb|CAA71442.1| soluble starch (bacterial glycogen) synthase [Solanum tuberosum] Length = 641 Score = 78.6 bits (192), Expect = 2e-12 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -3 Query: 441 CDILLMPSRFEPCGLNQLYAMRYGTIPVVHATGGLR 334 CDILLMPSRFEPCGLNQLYAMRYGTIP+VH+TGGLR Sbjct: 522 CDILLMPSRFEPCGLNQLYAMRYGTIPIVHSTGGLR 557